Mouse RPS6KB1 Monoclonal Antibody | anti-RPS6KB1 antibody

RPS6KB1 (Ribosomal Protein S6 Kinase, 70kD, Polypeptide 1, PS6K, S6K, S6K1, STK14A, p70(S6K)-alpha, p70-S6K, p70-alpha) (AP)

Cat. Num. AAA25972

• Gene Names: RPS6KB1; S6K; PS6K; S6K1; STK14A; p70-S6K; p70 S6KA; p70-alpha; S6K-beta-1; p70(S6K)-alpha
• Applications: Western Blot
• Purity: Purified
• Synonyms: RPS6KB1, Antibody; RPS6KB1 (Ribosomal Protein S6 Kinase, 70kD, Polypeptide 1, PS6K, S6K, S6K1, STK14A, p70(S6K)-alpha, p70-S6K, p70-alpha) (AP); Ribosomal Protein S6 Kinase; 70kD; Polypeptide 1; PS6K; S6K; S6K1; STK14A; p70(S6K)-alpha; p70-S6K; p70-alpha; anti-RPS6KB1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4H4
• Specificity: Recognizes RPS6KB1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-RPS6KB1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: RPS6KB1 (NP_003152, 416aa-525aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(RPS6KB1 monoclonal antibody (M04), clone 4H4. Western Blot analysis of RPS6KB1 expression in PC-12.)

WB (Western Blot)

(RPS6KB1 monoclonal antibody (M04), clone 4H4. Western Blot analysis of RPS6KB1 expression in NIH/3T3.)

Application Data

(Detection limit for recombinant GST tagged RPS6KB1 is approximately 0.1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to RPS6KB1 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to RPS6KB1 on HeLa cell. [antibody concentration 10 ug/ml])

WB (Western Blot)

(RPS6KB1 monoclonal antibody (M04), clone 4H4 Western Blot analysis of RPS6KB1 expression in HeLa.)

Related Product Information for anti-RPS6KB1 antibody

This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein. The kinase activity of this protein leads to an increase in protein synthesis and cell proliferation. Amplification of the region of DNA encoding this gene and overexpression of this kinase are seen in some breast cancer cell lines. Alternate translational start sites have been described and alternate transcriptional splice variants have been observed but have not been thoroughly characterized. [provided by RefSeq]

Product Categories/Family for anti-RPS6KB1 antibody

Antibodies; Ribosomal Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4506737
• NCBI GeneID: 6198
• NCBI Accession #: NP_003152
• NCBI GenBank Nucleotide #: NM_003161.3
• UniProt Accession #: P23443; Q7Z721; B2R779; B4DLT4; B4DTG1; E7ESB8; F6UYM1
• Molecular Weight: 60.2kDa (533aa) 70-100kDa (SDS-PAGE under reducing conditions.)
• NCBI Official Full Name: ribosomal protein S6 kinase beta-1 isoform a
• NCBI Official Synonym Full Names: ribosomal protein S6 kinase B1
• NCBI Official Symbol: RPS6KB1
• NCBI Official Synonym Symbols: S6K; PS6K; S6K1; STK14A; p70-S6K; p70 S6KA; p70-alpha; S6K-beta-1; p70(S6K)-alpha
• NCBI Protein Information: ribosomal protein S6 kinase beta-1
• UniProt Protein Name: Ribosomal protein S6 kinase beta-1
• UniProt Gene Name: RPS6KB1
• UniProt Synonym Gene Names: STK14A; S6K-beta-1; S6K1; P70S6K1; p70-S6K 1; p70 S6 kinase alpha; p70 S6K-alpha; p70 S6KA
• UniProt Entry Name: KS6B1_HUMAN