Mouse OPA1 Monoclonal Antibody | anti-OPA1 antibody

OPA1 (Pptic Atrophy 1 (Autosomal Dominant), FLJ12460, KIAA0567, MGM1, NPG, NTG, LargeG) (FITC)

Cat. Num. AAA26419

• Gene Names: OPA1; NPG; NTG; MGM1; BERHS; largeG; MTDPS14
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: OPA1, Antibody; OPA1 (Pptic Atrophy 1 (Autosomal Dominant), FLJ12460, KIAA0567, MGM1, NPG, NTG, LargeG) (FITC); Pptic Atrophy 1 (Autosomal Dominant); FLJ12460; KIAA0567; MGM1; NPG; NTG; LargeG; anti-OPA1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 8A32
• Specificity: Recognizes OPA1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 960

• Applicable Applications for anti-OPA1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: OPA1 (NP_056375, 851aa-960aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NHCNLCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of OPA1 expression in transfected 293T cell line by OPA1 monoclonal antibody (M06), clone 8A32.Lane 1: OPA1 transfected lysate (Predicted MW: 111.6 KDa).Lane 2: Non-transfected lysate.)

Application Data

(Detection limit for recombinant GST tagged OPA1 is 0.1 ng/ml as a capture antibody.)

WB (Western Blot)

(OPA1 monoclonal antibody (M06), clone 8A32. Western Blot analysis of OPA1 expression in rat brain.)

WB (Western Blot)

(OPA1 monoclonal antibody (M06), clone 8A32. Western Blot analysis of OPA1 expression in human ovarian cancer.)

WB (Western Blot)

(OPA1 monoclonal antibody (M06), clone 8A32. Western Blot analysis of OPA1 expression in PC-12.)

WB (Western Blot)

(OPA1 monoclonal antibody (M06), clone 8A32. Western Blot analysis of OPA1 expression in Daoy.)

Related Product Information for anti-OPA1 antibody

This gene product is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. It is a component of the mitochondrial network. Mutations in this gene have been associated with optic atrophy type 1, which is a dominantly inherited optic neuropathy resulting in progressive loss of visual acuity, leading in many cases to legal blindness. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Product Categories/Family for anti-OPA1 antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 224831243
• NCBI GeneID: 4976
• NCBI Accession #: NP_056375
• NCBI GenBank Nucleotide #: NP_056375.2
• UniProt Accession #: O60313
• NCBI Official Full Name: dynamin-like 120 kDa protein, mitochondrial isoform 1 preproprotein
• NCBI Official Synonym Full Names: OPA1 mitochondrial dynamin like GTPase
• NCBI Official Symbol: OPA1
• NCBI Official Synonym Symbols: NPG; NTG; MGM1; BERHS; largeG; MTDPS14
• NCBI Protein Information: dynamin-like 120 kDa protein, mitochondrial
• UniProt Protein Name: Dynamin-like 120 kDa protein, mitochondrial
• UniProt Gene Name: OPA1
• UniProt Synonym Gene Names: KIAA0567
• UniProt Entry Name: OPA1_HUMAN