Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA13703_SDS_PAGE.jpg SDS-PAGE (4-20% SDS-PAGE: purified gH/gp42(EBV) protein complex)

EBV (HHV-4) gH/gp42 Recombinant Protein | EBV recombinant protein

EBV (HHV-4) gH/gp42 Protein Complex

Applications
Western Blot, ELISA
Purity
>95% pure by 10% SDS-PAGE gel
Synonyms
EBV (HHV-4) gH/gp42; N/A; EBV (HHV-4) gH/gp42 Protein Complex; EBV recombinant protein
Ordering
For Research Use Only!
Host
HEK293 cells
Purity/Purification
>95% pure by 10% SDS-PAGE gel
Concentration
50ug (1ug/ul) in PBS (varies by lot)
Sequence
SLSEVKLHLDIEGHASHYTIPWTELMAKVPGLSPEALWREANVTEDLASMLNRYKLIYKTSGTLGIALAEPVDIPAVSEGSMQVDASKVHPGVISGLNSPACMLSAPLEKQLFYYIGTMLPNTRPHSVFYQLRCHLSYVALSINGDKFQYTGAMTSKFLMGTYKRVTEKGDEHVLSLVFGKTKDLPDLRGPFSYPSLTSAQSGDYSLVIVTTFVHYANFHNYFVPNLKDMFSRAVTMTAASYARYVLQKLVLLEKGGCREPELDTETLTTMFEVSVAFFKVGHAVGETGNGCVDLRWLAKSFFELTVLKDIIGICYGATVKGMQSYGLERLAAMLMATVKMEELGHLTTEKQEYALRLATVGYPKAGVYSGLIGGATSVLLAYNRHPLFQPLHTVMRETLFIGSHVVLRELRLNVTTQGPNLALYQLLSTALCSALEIGEVLRGLALGTESGLFSPCYLSLRFDLTRDKLLSMAPQEATLDQAAVSNAVDGFLGRLSLEREDRDAWHLAYKCVDRLDKVLMIIPLINVTFIISSDREVRGSALYEASTTYLSSSLFLSPVIMNKCSQGAVAGEPRQIPKIQNFTRTQKSCIFCGFALLSYDEKEGLETTTYITSQEVQNSILSSNYFDFDNLHVHLLLTTNGTVMEIAGLYEERA GGRVAAAAITWVPKPNVEVWPVDPPPPVNFNKTAEQEYGDKEVKLPHWTPTLHTFQVPQNYTKANCTYCNTREYTFSYKGCCFYFTKKKHTWNGCFQACAELYPCTYFYGPTPDILPVVTRNLNAIELWVGVYRVGEGNWTSLDGGTFKVYQIFGSHCTYVSKFSTVPVSHHECSFLKPCLCVSQRSNS
Applicable Applications for EBV recombinant protein
Western Blot standard (WB), antibody ELISA (EIA), Immunogen
Source
Expressed and purified from HEK293 cells
Endotoxin Level
< 0.01 EU per 1 ug of the protein by LAL test
Viral Protein
Recombinant EBV gH protein (amino acid 19-678) (GenBank accession#: P03231) and EBV gp42 (aa 34-223) (GenBank accession#: YP_401672) complex
Preparation and Storage
Store at -20°C. Stable for two weeks from the date of receipt when kept at 4°C.

SDS-PAGE

(4-20% SDS-PAGE: purified gH/gp42(EBV) protein complex)

product-image-AAA13703_SDS_PAGE.jpg SDS-PAGE (4-20% SDS-PAGE: purified gH/gp42(EBV) protein complex)
Related Product Information for EBV recombinant protein
Introduction: Herpesviruses have an envelope andan outer lipid bilayer which contains twelve surface glycoproteins. For infectivity to be attained, the double stranded DNA genome of EBV must enter the host cell through means of fusion of its envelope with the cellular membrane or via endocytosis. Epstein–Barr virus (EBV)can infect both B cells and epithelial cells. The mechanisms for entering these two cells are different. The viral three-part glycoprotein complexes of gHgL/gp42 mediate B cell membrane fusion.

Description: Recombinant EBV glycoprotein Hand gp42 proteins expressed and purified from 293 cells.
Product Categories/Family for EBV recombinant protein

NCBI and Uniprot Product Information

UniProt Accession #
UniProt Protein Name
Envelope glycoprotein H
UniProt Gene Name
gH
UniProt Synonym Gene Names
gH; gp85
UniProt Entry Name
GH_EBVB9

Similar Products

Product Notes

The EBV gh (Catalog #AAA13703) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's EBV (HHV-4) gH/gp42 can be used in a range of immunoassay formats including, but not limited to, Western Blot standard (WB), antibody ELISA (EIA), Immunogen. Researchers should empirically determine the suitability of the EBV gh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SLSEVKLHLD IEGHASHYTI PWTELMAKVP GLSPEALWRE ANVTEDLASM LNRYKLIYKT SGTLGIALAE PVDIPAVSEG SMQVDASKVH PGVISGLNSP ACMLSAPLEK QLFYYIGTML PNTRPHSVFY QLRCHLSYVA LSINGDKFQY TGAMTSKFLM GTYKRVTEKG DEHVLSLVFG KTKDLPDLRG PFSYPSLTSA QSGDYSLVIV TTFVHYANFH NYFVPNLKDM FSRAVTMTAA SYARYVLQKL VLLEKGGCRE PELDTETLTT MFEVSVAFFK VGHAVGETGN GCVDLRWLAK SFFELTVLKD IIGICYGATV KGMQSYGLER LAAMLMATVK MEELGHLTTE KQEYALRLAT VGYPKAGVYS GLIGGATSVL LAYNRHPLFQ PLHTVMRETL FIGSHVVLRE LRLNVTTQGP NLALYQLLST ALCSALEIGE VLRGLALGTE SGLFSPCYLS LRFDLTRDKL LSMAPQEATL DQAAVSNAVD GFLGRLSLER EDRDAWHLAY KCVDRLDKVL MIIPLINVTF IISSDREVRG SALYEASTTY LSSSLFLSPV IMNKCSQGAV AGEPRQIPKI QNFTRTQKSC IFCGFALLSY DEKEGLETTT YITSQEVQNS ILSSNYFDFD NLHVHLLLTT NGTVMEIAGL YEERA GGR VAAAAITWVP KPNVEVWPVD PPPPVNFNKT AEQEYGDKEV KLPHWTPTLH TFQVPQNYTK ANCTYCNTRE YTFSYKGCCF YFTKKKHTWN GCFQACAELY PCTYFYGPTP DILPVVTRNL NAIELWVGVY RVGEGNWTSL DGGTFKVYQI FGSHCTYVSK FSTVPVSHHE CSFLKPCLCV SQRSNS. It is sometimes possible for the material contained within the vial of "EBV (HHV-4) gH/gp42, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.