HA (A/Wisconsin/588/2019)(H1N1)-pdm09-like virus Recombinant Protein
HA (A/Wisconsin/588/2019)(H1N1)-pdm09-like virus
Applications
Western Blot, ELISA
Purity
> 95% (SDS-PAGE)
Synonyms
HA (A/Wisconsin/588/2019)(H1N1)-pdm09-like virus; N/A; Hemagglutinin HA; HA (A/Wisconsin/588/2019)(H1N1)-pdm09-like virus recombinant protein
Host
HEK293 Cells
Purity/Purification
> 95% (SDS-PAGE)
Concentration
50 ug (0.5 ug/ul) in PBS (varies by lot)
Sequence
DTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTARSWSYIVETSNSDNGTCYPGDFINYE ELREQLSSVSSFERFEIFPKTSSWPNHDSDNGVTAACPHAGAKSFYKNLIWLVKKGKSYPKINQTYINDKGKEVLVLWGIHHPPTIADQQSLYQNADAY VFVGTSRYSKKFKPEIATRPKVRDQEGRMNYYWTLVEPGDKITFEATGNLVAPRYAFTMERDAGSGIIISDTPVHDCNTTCQTPEGAINTSLPFQNVHP ITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDKITNKVNSVIEKMNTQFTAVGKE FNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRNQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGTYDYPKYSEEAKL NREKIDGVKLDSTRIYQI
Applicable Applications for HA (A/Wisconsin/588/2019)(H1N1)-pdm09-like virus recombinant protein
Western Blot (WB), ELISA (EIA), Immunogen
Source Note
Glycosylated recombinant hemagglutinin protein expressed and purified from HEK293 cells
Viral Protein
C-terminal 8x His tagged hemagglutinin (aa 18-530)(A/Wisconsin/588/2019/H1N1)padm09-like virus protein (GenBank Accession#:QRV63266). A trimerization domain sequence has been introduced into the C-terminal of HA to stabilize the formation of trimer HA.
Endotoxin
<0.01 EU per 1 ug of purified protein by LAL test
Preparation and Storage
Store at -20°C; Stable for 6-months from the date of receipt when kept at 4°C. Non-hazardous. No MSDS required.
Related Product Information for HA (A/Wisconsin/588/2019)(H1N1)-pdm09-like virus recombinant protein
Introduction: Influenza hemagglutinin (HA) is a type of hemagglutinin found on the surface of the influenza viruses. HA is an antigenic glycoprotein, like all other hemagglutinins, it causes red blood cells to agglutinate. HA is responsible for binding the virus to the cell that is being infected. HA proteins bind to cells with sialic acid on the membranes, such as cells in the upper respiratory tract or erythrocytes.
HA is a homotrimeric integral membrane glycoprotein. HA monomer is synthesized as a single polypeptide that is subsequently cleaved into two smaller polypeptides, the HA1 and HA2 subunits. Each HA monomer consists of a long, helical chain anchored in the membrane by HA2 and topped by a large HA1 globule.
Description: Recombinant HA protein expressed and purified from HEK293 cells
HA is a homotrimeric integral membrane glycoprotein. HA monomer is synthesized as a single polypeptide that is subsequently cleaved into two smaller polypeptides, the HA1 and HA2 subunits. Each HA monomer consists of a long, helical chain anchored in the membrane by HA2 and topped by a large HA1 globule.
Description: Recombinant HA protein expressed and purified from HEK293 cells
Similar Products
Product Notes
The HA (A/Wisconsin/588/2019)(H1N1)-pdm09-like virus (Catalog #AAA13790) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HA (A/Wisconsin/588/2019)(H1N1)-pdm09-like virus can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), ELISA (EIA), Immunogen. Researchers should empirically determine the suitability of the HA (A/Wisconsin/588/2019)(H1N1)-pdm09-like virus for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DTLCIGYHAN NSTDTVDTVL EKNVTVTHSV NLLEDKHNGK LCKLRGVAPL HLGKCNIAGW ILGNPECESL STARSWSYIV ETSNSDNGTC YPGDFINYE ELREQLSSVS SFERFEIFPK TSSWPNHDSD NGVTAACPHA GAKSFYKNLI WLVKKGKSYP KINQTYINDK GKEVLVLWGI HHPPTIADQQ SLYQNADAY VFVGTSRYSK KFKPEIATRP KVRDQEGRMN YYWTLVEPGD KITFEATGNL VAPRYAFTME RDAGSGIIIS DTPVHDCNTT CQTPEGAINT SLPFQNVHP ITIGKCPKYV KSTKLRLATG LRNVPSIQSR GLFGAIAGFI EGGWTGMVDG WYGYHHQNEQ GSGYAADLKS TQNAIDKITN KVNSVIEKMN TQFTAVGKE FNHLEKRIEN LNKKVDDGFL DIWTYNAELL VLLENERTLD YHDSNVKNLY EKVRNQLKNN AKEIGNGCFE FYHKCDNTCM ESVKNGTYDY PKYSEEAKL NREKIDGVKL DSTRIYQI. It is sometimes possible for the material contained within the vial of "HA (A/Wisconsin/588/2019)(H1N1)-pdm09-like virus, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
