Rabbit anti-Human CD63 Monoclonal Antibody | anti-CD63 antibody

CD63 Rabbit mAb

Cat. Num. AAA28468

• Reactivity: Human
• Applications: Western Blot, Immunohistochemistry, ELISA
• Purity: Affinity purification
• Synonyms: CD63, Antibody; CD63 Rabbit mAb; MLA1; ME491; LAMP-3; OMA81H; TSPAN30; CD63; anti-CD63 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
• Sequence: AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

• Applicable Applications for anti-CD63 antibody: Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), ELISA (EIA)
• Application Notes: WB: 1:1000-1:2000; IHC-P: 1:2000-1:10000; ELISA: Recommended starting concentration is 1ug/mL.; Please optimize the concentration based on your specific assay requirements.
• Cross Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 103-203 of human CD63 (NP_001771.1).
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human tonsil using CD63 Rabbit mAb (AAA28468) at dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human colon using CD63 Rabbit mAb (AAA28468) at dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using CD63 Rabbit mAb (AAA28468) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)

WB (Western Blot)

(Western blot analysis of various lysates using CD63 Rabbit mAb (AAA28468) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

WB (Western Blot)

(Western blot analysis of various lysates, using CD63 Rabbit mAb (AAA28468) at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)

WB (Western Blot)

(Western blot analysis of lysates from A375 cells, using CD63 Rabbit mAb (AAA28468) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

Related Product Information for anti-CD63 antibody

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms.

Product Categories/Family for anti-CD63 antibody

Cancer; Tumor biomarkers; Invasion and Metastasis; Cell Biology Developmental Biology; Cell Adhesion; Immunology Inflammation; CDs; Cardiovascular; Blood; Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 189384
• NCBI GeneID: 967
• UniProt Accession #: P08962; Q5TZP3; Q8N6Z9; Q9UCG6; F8VZE2
• Molecular Weight: Calculated MW: 17kDa/23kDa/25kDa; Observed MW: 30-65kDa
• UniProt Protein Name: CD63 antigen
• UniProt Gene Name: CD63
• UniProt Synonym Gene Names: MLA1; TSPAN30; LAMP-3; Tspan-30