Host
E Coli
Purity/Purification
>95% purity
Concentration
1 ug/ul in PBS with 6M Urea (varies by lot)
Sequence
IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYL DKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHETDENR AKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWFHDIPLPWHAGADTGTPHWNNKEALVEFK DAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTV EVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGKA FEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFGAAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALG GVLIFLSTAVSAHHHHHH
Applicable Applications for Zika Virus Envelope Protein recombinant protein
Western blot standard, antibody ELISA, antigen, etc.
Endotoxin
<0.01 EU per 1ug of the protein by LAL test
Viral Protein
C-terminal 6xHis tagged envelope protein (amino acid 1-504) of Zika virus (Genebank No. AMA12087)
Dry Ice Shipment
Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
Preparation and Storage
Store at -20°C; Stable for 1-months from the date of shipment when kept at 4°C. Non-hazardous. No MSDS required.
Related Product Information for Zika Virus Envelope Protein recombinant protein
Description: 6xHis tagged recomibant protein expressed in E.coli.
Introduction: Zika virus (ZIKV), a Flaviviridae family member, is a single-stranded, positive-sense RNA virus with a 10.7 Kb genome encoding a single polyprotein that is cleaved into three structural proteins: capsid (C), precursor of membrane (prM), envelop (E) and seven non-structural proteins: NS1, NS2A, NS2B, NS3, NS4A, NS4B, NS5. The flavivirus envelope (E) glycoprotein is responsible for virus entry and represents a major target of neutralizing antibodies for other flaviviruses.
Introduction: Zika virus (ZIKV), a Flaviviridae family member, is a single-stranded, positive-sense RNA virus with a 10.7 Kb genome encoding a single polyprotein that is cleaved into three structural proteins: capsid (C), precursor of membrane (prM), envelop (E) and seven non-structural proteins: NS1, NS2A, NS2B, NS3, NS4A, NS4B, NS5. The flavivirus envelope (E) glycoprotein is responsible for virus entry and represents a major target of neutralizing antibodies for other flaviviruses.
Similar Products
Product Notes
The Zika Virus Envelope Protein (Catalog #AAA13773) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Zika Virus Envelope Protein can be used in a range of immunoassay formats including, but not limited to, Western blot standard, antibody ELISA, antigen, etc. Researchers should empirically determine the suitability of the Zika Virus Envelope Protein for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IRCIGVSNRD FVEGMSGGTW VDVVLEHGGC VTVMAQDKPT VDIELVTTTV SNMAEVRSYC YEASISDMAS DSRCPTQGEA YL DKQSDTQYVC KRTLVDRGWG NGCGLFGKGS LVTCAKFACS KKMTGKSIQP ENLEYRIMLS VHGSQHSGMI VNDTGHETDE NR AKVEITPNSP RAEATLGGFG SLGLDCEPRT GLDFSDLYYL TMNNKHWLVH KEWFHDIPLP WHAGADTGTP HWNNKEALVE FK DAHAKRQTVV VLGSQEGAVH TALAGALEAE MDGAKGRLSS GHLKCRLKMD KLRLKGVSYS LCTAAFTFTK IPAETLHGTV TV EVQYAGTDGP CKVPAQMAVD MQTLTPVGRL ITANPVITES TENSKMMLEL DPPFGDSYIV IGVGEKKITH HWHRSGSTIG KA FEATVRGAKR MAVLGDTAWD FGSVGGALNS LGKGIHQIFG AAFKSLFGGM SWFSQILIGT LLMWLGLNTK NGSISLMCLA LG GVLIFLSTAV SAHHHHHH. It is sometimes possible for the material contained within the vial of "Zika Virus Envelope Protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
