High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A) Recombinant Protein | FCER1A recombinant protein

Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial

Cat. Num. AAA18475

• Gene Names: FCER1A; FCE1A; FcERI
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A); N/A; Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial; High affinity immunoglobulin epsilon receptor subunit alpha; Fc-epsilon RI-alpha; FcERI; IgE Fc receptor subunit alpha; FCER1A recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 26-205aa; partial
• Sequence: VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for FCER1A recombinant protein

Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.

Product Categories/Family for FCER1A recombinant protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 4503675
• NCBI GeneID: 2205
• NCBI Accession #: NP_001992.1
• NCBI GenBank Nucleotide #: NM_002001.3
• UniProt Accession #: P12319
• Molecular Weight: 23 kDa
• NCBI Official Full Name: high affinity immunoglobulin epsilon receptor subunit alpha
• NCBI Official Synonym Full Names: Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide
• NCBI Official Symbol: FCER1A
• NCBI Official Synonym Symbols: FCE1A; FcERI
• NCBI Protein Information: high affinity immunoglobulin epsilon receptor subunit alpha; Fc-epsilon RI-alpha; Fc epsilon RI alpha-chain; igE Fc receptor subunit alpha; Fc IgE receptor, alpha polypeptide; high affinity immunoglobulin epsilon receptor alpha-subunit; immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide
• UniProt Protein Name: High affinity immunoglobulin epsilon receptor subunit alpha
• UniProt Gene Name: FCER1A
• UniProt Synonym Gene Names: FCE1A; FcERI
• UniProt Entry Name: FCERA_HUMAN