<
Rabbit HNRPA0 Polyclonal Antibody | anti-HNRNPA0 antibody
HNRPA0 antibody - middle region
Gene Names
HNRNPA0; HNRPA0
Reactivity
Cow, Dog, Human, Pig
Applications
Immunofluorescence, Immunoprecipitation, Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
HNRPA0, Antibody; HNRPA0 antibody - middle region; anti-HNRNPA0 antibody
Host
Rabbit
Reactivity
Cow, Dog, Human, Pig
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG
Sequence Length
305
Applicable Applications for anti-HNRNPA0 antibody
Immunofluorescence (IF), Immunoprecipitation (IP), Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Human: 100%; Pig: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HNRPA0
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-HNRPA0 Antibody Titration: 0.625ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
WB (Western Blot)
(Sample Type: HeLa S3, MCF7, K562Lanes :Lane 1: 20ug HeLa S3 lysate Lane 2: 20ug MCF7 lysate Lane 3: 20ug K562 lysatePrimary Antibody Dilution :1:4000Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution :1:5000Gene Name :HNRPA0Submitted by :Anonymous)
IP (Immunoprecipitation)
(Sample Type: K562Amount and Sample Type :Lane 1: 5% InputLane 2: 5% SupLane 3: Normal IgGLane 4: hn-RNPA0 ppt. k562 sampleIP Antibody :HNRPA0Amount of IP Antibody :Primary Antibody :HNRPA0Primary Antibody Dilution:1:4000Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution:1:5000Gene Name :HNRPA0Submitted by:Anonymous)
IHC (Immunohistochemistry)
(Rabbit Anti-HNRPA0 AntibodyParaffin Embedded Tissue: Human LiverCellular Data: HepatocytesAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohistochemistry)
(Rabbit Anti-HNRPA0 AntibodyParaffin Embedded Tissue: Human HeartCellular Data: Myocardial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohistochemistry)
(Rabbit Anti-HNRNPA0 AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IF (Immunofluorescence)
(Sample Type: MCF-7Sample Type :MCF7 cellsPrimary Antibody Dilution :1:200Secondary Antibody:Anti-rabbit-FITCSecondary Antibody Dilution:1:500Color/Signal Descriptions:DAPI: Blue hn-RNPA0: GreenGene Name:HNRPA0Submitted by:Anonymous)
Related Product Information for anti-HNRNPA0 antibody
This is a rabbit polyclonal antibody against HNRPA0. It was validated on Western Blot and immunohistochemistry
Target Description: HNRPA0 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus.This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus.
Target Description: HNRPA0 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus.This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus.
Product Categories/Family for anti-HNRNPA0 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein A0
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein A0
NCBI Official Symbol
HNRNPA0
NCBI Official Synonym Symbols
HNRPA0
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein A0
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein A0
UniProt Gene Name
HNRNPA0
UniProt Synonym Gene Names
HNRPA0; hnRNP A0
UniProt Entry Name
ROA0_HUMAN
