Mouse ZNF622 Monoclonal Antibody | anti-ZNF622 antibody

ZNF622 (Zinc Finger Protein 622, Zinc Finger-like Protein 9, ZPR9)

Cat. Num. AAA24100

• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ZNF622, Antibody; ZNF622 (Zinc Finger Protein 622, Zinc Finger-like Protein 9, ZPR9); Anti -ZNF622 (Zinc Finger Protein 622, Zinc Finger-like Protein 9, ZPR9); anti-ZNF622 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3C5
• Specificity: Recognizes human ZNF622. Species Crossreactivity: mouse and rat.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEEESKGSATYCTVCSKKFASFNAYENHLKSRRHVELEKKAVQ

• Applicable Applications for anti-ZNF622 antibody: ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence, ELISA and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Partial recombinant corresponding to aa1-101 from human ZNF622 (NP_219482) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(ZNF622 monoclonal antibody. Western Blot analysis of ZNF622 expression in Raw 264.7.)

WB (Western Blot)

(ZNF622 monoclonal antibody. Western Blot analysis of ZNF622 expression in Hela NE.)

Application Data

(Detection limit for recombinant GST tagged ZNF622 is ~0.03ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to ZNF622 on HeLa cell. [antibody concentration 10ug/ml].)

WB (Western Blot)

(Western Blot analysis of ZNF622 expression in transfected 293T cell line by ZNF622 monoclonal antibody.Lane 1: ZNF622 transfected lysate (54.3kD).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(ZNF622 monoclonal antibody. Western Blot analysis of ZNF622 expression in PC-12.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.11kD).)

Product Categories/Family for anti-ZNF622 antibody

Antibodies; Abs to Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 77735857
• NCBI GeneID: 513617
• NCBI Accession #: NP_001029623.1
• NCBI GenBank Nucleotide #: NM_001034451.1
• NCBI Official Full Name: zinc finger protein 622
• NCBI Official Synonym Full Names: zinc finger protein 622<
• NCBI Official Symbol: ZNF622
• NCBI Protein Information: zinc finger protein 622