Mouse anti-Human CD142 Monoclonal Antibody | anti-CD142 antibody

CD142 (CD142 Antigen, Coagulation Factor III, F3, Tissue Factor, TF, TFA, Thromboplastin) APC

Cat. Num. AAA24455

• Gene Names: F3; TF; TFA; CD142
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CD142, Antibody; CD142 (CD142 Antigen, Coagulation Factor III, F3, Tissue Factor, TF, TFA, Thromboplastin) APC; anti-CD142 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G4
• Specificity: Recognizes human F3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-CD142 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa45-154 from human F3 (AAH11029) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-CD142 antibody

CD142, a 45kD cell surface glycoprotein which is also known as Tissue Factor. CD142 expression can be induced on monocytes, macrophages and endothelial cells by various stimuli including interleukin 1, tumor necrosis factor and endotoxin. CD142 initiates the blood clotting cascade by binding coagulation Factor VIIa, which activates Factor IX or Factor X by specific limited proteolysis. CD142 also plays an important role in inflammation, angiogenesis, and the pathophysiology of atherosclerosis and cancer.

Product Categories/Family for anti-CD142 antibody

Antibodies; Coagulation Factors

NCBI and Uniprot Product Information

• NCBI GI #: 15029642
• NCBI GeneID: 2152
• Molecular Weight: 27,145 Da
• NCBI Official Full Name: Homo sapiens coagulation factor III (thromboplastin, tissue factor), mRNA
• NCBI Official Synonym Full Names: coagulation factor III, tissue factor
• NCBI Official Symbol: F3
• NCBI Official Synonym Symbols: TF; TFA; CD142
• NCBI Protein Information: tissue factor