Mouse anti-Human RAB7B Monoclonal Antibody | anti-RAB7B antibody

RAB7B (Ras-related Protein Rab-7b, RAB7) APC

Cat. Num. AAA24629

• Gene Names: RAB7B; RAB7
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RAB7B, Antibody; RAB7B (Ras-related Protein Rab-7b, RAB7) APC; MGC16212; MGC9726; anti-RAB7B antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3B3
• Specificity: Recognizes human RAB7B.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 199

• Applicable Applications for anti-RAB7B antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody.; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa100-200 from human RAB7B (NP_796377) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC*
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(RAB7B monoclonal antibody. Western Blot analysis of RAB7B expression in A-431.)

Application Data

(Detection limit for recombinant GST tagged RAB7B is ~0.03ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of RAB7B transfected lysate using RAB7B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RAB7B rabbit polyclonal antibody.)

WB (Western Blot)

(Western Blot analysis of RAB7B expression in transfected 293T cell line by RAB7B monoclonal antibody. Lane 1: RAB7B transfected lysate (22.5kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(RAB7B monoclonal antibody. Western Blot analysis of RAB7B expression in human kidney.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.11kD).)

Product Categories/Family for anti-RAB7B antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

References

1. Zlatic SA, Tornieri K, L'hernault SW, Faundez V.Mol Biol Cell. 2011 May;22(10):1699-715. Epub 2011 Mar 16. 2. Higashi S, Moore DJ, Yamamoto R, Minegishi M, Sato K, Togo T, Katsuse O, Uchikado H, Furukawa Y, Hino H, Kosaka K, Emson PC, Wada K, Dawson VL, Dawson TM, Arai H, Iseki E.J Neuropathol Exp Neurol. 2009 Sep;68(9):994-1005. 3.GIGYF2 is present in endosomal compartments in the mammalian brains and enhances IGF-1-induced ERK1/2 activation. Higashi S, Iseki E, Minegishi M, Togo T, Kabuta T, Wada K.J Neurochem. 2010 Jul 28. 4. Zhu GD, Salazar G, Zlatic SA, Fiza B, Doucette MM, Heilman CJ, Levey AI, Faundez V, L'hernault SW.Mol Biol Cell. 2009 Feb;20(4):1223-1240. Epub 2008 Dec 24.

NCBI and Uniprot Product Information

• NCBI GI #: 256985158
• NCBI GeneID: 338382
• NCBI Accession #: NP_796377
• NCBI GenBank Nucleotide #: NM_177403
• UniProt Accession #: Q96AH8
• NCBI Official Full Name: ras-related protein Rab-7b isoform a
• NCBI Official Synonym Full Names: RAB7B, member RAS oncogene family
• NCBI Official Symbol: RAB7B
• NCBI Official Synonym Symbols: RAB7
• NCBI Protein Information: ras-related protein Rab-7b
• UniProt Protein Name: Ras-related protein Rab-7b
• UniProt Gene Name: RAB7B
• UniProt Entry Name: RAB7B_HUMAN