Mouse SWAP70 Monoclonal Antibody | anti-SWAP70 antibody

SWAP70 (Switch-associated Protein 70, SWAP-70, HSPC321, KIAA0640) APC

Cat. Num. AAA24677

• Gene Names: SWAP70; HSPC321; SWAP-70
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SWAP70, Antibody; SWAP70 (Switch-associated Protein 70, SWAP-70, HSPC321, KIAA0640) APC; anti-SWAP70 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3H8
• Specificity: Recognizes human SWAP70. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 4884

• Applicable Applications for anti-SWAP70 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa378-452 from SWAP70 (NP_055870) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQA*
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(SWAP70 monoclonal antibody Western Blot analysis of SWAP70 expression in PC-12)

WB (Western Blot)

(Western Blot detection against Immunogen (34.25kD).)

Application Data

(Detection limit for recombinant GST tagged SWAP70 is ~0.1ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to SWAP70 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of SWAP70 expression in transfected 293T cell line by SWAP70 monoclonal antibody Lane 1: SWAP70 transfected lysate (69kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(SWAP70 monoclonal antibody Western Blot analysis of SWAP70 expression in NIH/3T3)

Product Categories/Family for anti-SWAP70 antibody

Antibodies; Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 1519243628
• NCBI GeneID: 23075
• NCBI Accession #: NM_015055.4
• NCBI GenBank Nucleotide #: NM_015055
• NCBI Official Full Name: Homo sapiens switching B cell complex subunit SWAP70 (SWAP70), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: switching B cell complex subunit SWAP70
• NCBI Official Symbol: SWAP70
• NCBI Official Synonym Symbols: HSPC321; SWAP-70
• NCBI Protein Information: switch-associated protein 70