Mouse FKBP4 Monoclonal Antibody | anti-FKBP4 antibody

FKBP4 (FK506-binding Protein 4, Peptidyl-prolyl cis-trans Isomerase FKBP4, PPIase FKBP4, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 52kD FK506-binding Protein, 52kD FKBP, FKBP-52, 59kD Immunophilin, FKBP59, p59 Protein, FKBP-4, FKBP52) (HRP)

Cat. Num. AAA25394

• Gene Names: FKBP4; HBI; p52; Hsp56; FKBP51; FKBP52; FKBP59; PPIase
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FKBP4, Antibody; FKBP4 (FK506-binding Protein 4, Peptidyl-prolyl cis-trans Isomerase FKBP4, PPIase FKBP4, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 52kD FK506-binding Protein, 52kD FKBP, FKBP-52, 59kD Immunophilin, FKBP59, p59 Protein, FKBP-4, FKBP52) (HRP); anti-FKBP4 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5C11
• Specificity: Recognizes human FKBP4. Species Crossreactivity: mouse and rat
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 2196

• Applicable Applications for anti-FKBP4 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa301-410 from human FKBP4 with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

IHC (Immunohistochemistry)

(Immunoperoxidase of paraffin-embedded human uterine cervix using 126835 (0.5ug/ml))

WB (Western Blot)

(Western Blot analysis of FKBP4 expression in Raw 264.7 using 126835.)

WB (Western Blot)

(Western Blot analysis of FKBP4 expression in PC-12 using 126835.)

WB (Western Blot)

(Western Blot analysis of FKBP4 expression in HeLa cells using 126835.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.84kD).)

Product Categories/Family for anti-FKBP4 antibody

Antibodies; Enzymes; Isomerase

References

1. Identification of a New Panel of Serum Autoantibodies Associated with the Presence of In situ Carcinoma of the Breast in Younger Women. Desmetz C, Bascoul-Mollevi C, Rochaix P, Lamy PJ, Kramar A, Rouanet P, Maudelonde T, Mange A, Solassol J.Clin Cancer Res. 2009 Jul 15;15(14):4733-41. Epub 2009 Jul 7.

NCBI and Uniprot Product Information

• NCBI GI #: 33873773
• NCBI GeneID: 2288
• NCBI Official Full Name: Homo sapiens FK506 binding protein 4, 59kDa, mRNA
• NCBI Official Synonym Full Names: FKBP prolyl isomerase 4
• NCBI Official Symbol: FKBP4
• NCBI Official Synonym Symbols: HBI; p52; Hsp56; FKBP51; FKBP52; FKBP59; PPIase
• NCBI Protein Information: peptidyl-prolyl cis-trans isomerase FKBP4