Mouse anti-Human PHB Monoclonal Antibody | anti-PHB antibody

PHB (Prohibitin) (HRP)

Cat. Num. AAA25495

• Gene Names: PHB; PHB1; HEL-215; HEL-S-54e
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PHB, Antibody; PHB (Prohibitin) (HRP); anti-PHB antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3F4-2B2
• Specificity: Recognizes human PHB.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-PHB antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 5ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-273 from human PHB (AAH13401) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVVFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAGDIAYQLSRSRNITYLPAGQSVLLQLPQ
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged PHB is ~0.03ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to PHB on HeLa cell. [antibody concentration 1 ~ 10ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to PHB on formalin-fixed paraffin-embedded human tonsil tissue.[antibody concentration 5ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to PHB on formalin-fixed paraffin-embedded human colon adenocarcinoma. [antibody concentration 5ug/ml])

WB (Western Blot)

(PHB monoclonal antibody. Western Blot analysis of PHB expression in Hela.)

WB (Western Blot)

(Western Blot detection against Immunogen (55.66kD).)

Product Categories/Family for anti-PHB antibody

Antibodies; Membrane Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 33870109
• NCBI GeneID: 5245
• Molecular Weight: 17,018 Da
• NCBI Official Full Name: Homo sapiens prohibitin, mRNA
• NCBI Official Synonym Full Names: prohibitin
• NCBI Official Symbol: PHB
• NCBI Official Synonym Symbols: PHB1; HEL-215; HEL-S-54e
• NCBI Protein Information: prohibitin