Mouse NME2 Monoclonal Antibody | anti-NME2 antibody

NME2 (Non-Metastatic Cells 2, Protein (NM23B) Expressed in, MGC111212, NDPK-B, NDPKB, NM23-H2, NM23B, puf) (AP)

Cat. Num. AAA25902

• Gene Names: NME2; PUF; NDKB; NDPKB; NM23B; NDPK-B; NM23-H2
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: NME2, Antibody; NME2 (Non-Metastatic Cells 2, Protein (NM23B) Expressed in, MGC111212, NDPK-B, NDPKB, NM23-H2, NM23B, puf) (AP); Non-Metastatic Cells 2; Protein (NM23B) Expressed in; MGC111212; NDPK-B; NDPKB; NM23-H2; NM23B; puf; anti-NME2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG3,k
• Clone Number: 1F2
• Specificity: Recognizes NME2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 152

• Applicable Applications for anti-NME2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: NME2 (NP_002503, 51aa-152aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: HYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(NME2 monoclonal antibody (M08), clone 1F2. Western Blot analysis of NME2 expression in Raw 264.7.)

WB (Western Blot)

(NME2 monoclonal antibody (M08), clone 1F2. Western Blot analysis of NME2 expression in PC-12.)

WB (Western Blot)

(NME2 monoclonal antibody (M08), clone 1F2. Western Blot analysis of NME2 expression in NIH/3T3.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to NME2 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to NME2 on HeLa cell. [antibody concentration 10 ug/ml])

WB (Western Blot)

(NME2 monoclonal antibody (M08), clone 1F2 Western Blot analysis of NME2 expression in HeLa.)

Related Product Information for anti-NME2 antibody

Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq]

Product Categories/Family for anti-NME2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4505409
• NCBI GeneID: 4831
• NCBI Accession #: NP_002503
• NCBI GenBank Nucleotide #: NP_002503.1
• UniProt Accession #: P22392
• NCBI Official Full Name: nucleoside diphosphate kinase B isoform a
• NCBI Official Synonym Full Names: NME/NM23 nucleoside diphosphate kinase 2
• NCBI Official Symbol: NME2
• NCBI Official Synonym Symbols: PUF; NDKB; NDPKB; NM23B; NDPK-B; NM23-H2
• NCBI Protein Information: nucleoside diphosphate kinase B
• UniProt Protein Name: Nucleoside diphosphate kinase B
• UniProt Gene Name: NME2
• UniProt Synonym Gene Names: NM23B; NDK B; NDP kinase B
• UniProt Entry Name: NDKB_HUMAN