Mouse GLUL Monoclonal Antibody | anti-GLUL antibody

GLUL (Glutamate-Ammonia Ligase (Glutamine Synthetase), GLNS, GS, PIG43, PIG59) (FITC)

Cat. Num. AAA26293

• Gene Names: GLUL; GS; GLNS; PIG43; PIG59
• Applications: Western Blot
• Purity: Purified
• Synonyms: GLUL, Antibody; GLUL (Glutamate-Ammonia Ligase (Glutamine Synthetase), GLNS, GS, PIG43, PIG59) (FITC); Glutamate-Ammonia Ligase (Glutamine Synthetase); GLNS; GS; PIG43; PIG59; anti-GLUL antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3B6
• Specificity: Recognizes GLUL.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-GLUL antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: GLUL (NP_002056, 274aa-373aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of GLUL expression in transfected 293T cell line by GLUL monoclonal antibody (M02), clone 3B6.Lane 1: GLUL transfected lysate (42.1 KDa).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(GLUL monoclonal antibody (M02), clone 3B6. Western Blot analysis of GLUL expression in Raw 264.7 (Cat # L024V1).)

WB (Western Blot)

(GLUL monoclonal antibody (M02), clone 3B6. Western Blot analysis of GLUL expression in PC-12 (Cat # L012V1).)

Application Data

(Detection limit for recombinant GST tagged GLUL is approximately 0.03ng/ml as a capture antibody.)

WB (Western Blot)

(GLUL monoclonal antibody (M02), clone 3B6. Western Blot analysis of GLUL expression in HepG2 (Cat # L019V1).)

WB (Western Blot)

(GLUL monoclonal antibody (M02), clone 3B6 Western Blot analysis of GLUL expression in Jurkat (Cat # L017V1).)

Related Product Information for anti-GLUL antibody

Glutamine is a main source of energy and is involved in cell proliferation, inhibition of apoptosis, and cell signaling (Haberle et al., 2005 [PubMed 16267323]). Fetal glutamine requirements are very high and depend largely on active glutamine synthesis and the release of glutamine into the fetal circulation by the placenta. Glutamine synthetase (EC 6.3.1.2), also called glutamate-ammonia ligase (GLUL), is expressed throughout the body and plays an important role in controlling body pH and in removing ammonia from the circulation. The enzyme clears L-glutamate, the major neurotransmitter in the central nervous system, from neuronal synapses (see references in Clancy et al., 1996 [PubMed 8975719]). [supplied by OMIM]

Product Categories/Family for anti-GLUL antibody

Antibodies; Enzymes; Decarboxylase

References

1. Optimisation of the quantification of glutamine synthetase and myelin basic protein in cerebrospinal fluid by a combined acidification and neutralisation protocol. Herbert MK, Kuiperij HB, Verbeek MM.J Immunol Methods. 2012 Apr 19.

NCBI and Uniprot Product Information

• NCBI GI #: 19923206
• NCBI GeneID: 2752
• NCBI Accession #: NP_002056
• NCBI GenBank Nucleotide #: NM_002065
• UniProt Accession #: P15104
• Molecular Weight: 42kDa
• NCBI Official Full Name: glutamine synthetase
• NCBI Official Synonym Full Names: glutamate-ammonia ligase
• NCBI Official Symbol: GLUL
• NCBI Official Synonym Symbols: GS; GLNS; PIG43; PIG59
• NCBI Protein Information: glutamine synthetase
• UniProt Protein Name: Glutamine synthetase
• UniProt Gene Name: GLUL
• UniProt Synonym Gene Names: GLNS; GS
• UniProt Entry Name: GLNA_HUMAN