Mouse AKT2 Monoclonal Antibody | anti-AKT2 antibody

AKT2 (v-akt Murine Thymoma Viral Oncogene Homolog 2, PKBB, PKBBETA, PRKBB, RAC-BETA) (FITC)

Cat. Num. AAA26412

• Gene Names: AKT2; PKBB; PRKBB; HIHGHH; PKBBETA; RAC-BETA
• Applications: Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: AKT2, Antibody; AKT2 (v-akt Murine Thymoma Viral Oncogene Homolog 2, PKBB, PKBBETA, PRKBB, RAC-BETA) (FITC); v-akt Murine Thymoma Viral Oncogene Homolog 2; PKBB; PKBBETA; PRKBB; RAC-BETA; anti-AKT2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: X1
• Specificity: Recognizes AKT2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 481

• Applicable Applications for anti-AKT2 antibody: Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: AKT2 (AAA58364, 100aa-189aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(AKT2 monoclonal antibody (M06), clone X1. Western Blot analysis of AKT2 expression in PC-12.)

WB (Western Blot)

(AKT2 monoclonal antibody (M06), clone X1. Western Blot analysis of AKT2 expression in NIH/3T3.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to AKT2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to AKT2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml])

Application Data

(Detection limit for recombinant GST tagged AKT2 is approximately 1ng/ml as a capture antibody.)

WB (Western Blot)

(AKT2 monoclonal antibody (M06), clone X1 Western Blot analysis of AKT2 expression in Jurkat (Cat # L017V1).)

Related Product Information for anti-AKT2 antibody

This gene is a putative oncogene encoding a protein belonging to a subfamily of serine/threonine kinases containing SH2-like (Src homology 2-like) domains. The gene was shown to be amplified and overexpressed in 2 of 8 ovarian carcinoma cell lines and 2 of 15 primary ovarian tumors. Overexpression contributes to the malignant phenotype of a subset of human ductal pancreatic cancers. The encoded protein is a general protein kinase capable of phophorylating several known proteins. [provided by RefSeq]

Product Categories/Family for anti-AKT2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 178326
• NCBI GeneID: 208
• NCBI Official Full Name: protein serine/threonine kinase
• NCBI Official Synonym Full Names: AKT serine/threonine kinase 2
• NCBI Official Symbol: AKT2
• NCBI Official Synonym Symbols: PKBB; PRKBB; HIHGHH; PKBBETA; RAC-BETA
• NCBI Protein Information: RAC-beta serine/threonine-protein kinase