<
Mouse SMAD2 Monoclonal Antibody | anti-SMAD2 antibody
SMAD2 (SMAD Family Member 2, JV18, JV18-1, MADH2, MADR2, MGC22139, MGC34440, hMAD-2, hSMAD2) (PE)
Gene Names
SMAD2; JV18; MADH2; MADR2; JV18-1; hMAD-2; hSMAD2
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
SMAD2, Antibody; SMAD2 (SMAD Family Member 2, JV18, JV18-1, MADH2, MADR2, MGC22139, MGC34440, hMAD-2, hSMAD2) (PE); SMAD Family Member 2; JV18; JV18-1; MADH2; MADR2; MGC22139; MGC34440; hMAD-2; hSMAD2; anti-SMAD2 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3G9
Specificity
Recognizes SMAD2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
467
Applicable Applications for anti-SMAD2 antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SMAD2 (AAH25699, 181aa-280aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYY
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Application Data
(Detection limit for recombinant GST tagged SMAD2 is approximately 0.1ng/ml as a capture antibody.)
WB (Western Blot)
(SMAD2 monoclonal antibody (M05), clone 3G9 Western Blot analysis of SMAD2 expression in Hela S3 NE (Cat # L013V3).)
IF (Immunofluorescence)
(Immunofluorescence of monoclonal antibody to SMAD2 on HeLa cell. [antibody concentration 10 ug/ml])
IF (Immunofluorescence)
(Immunofluorescence of monoclonal antibody to SMAD2 on HeLa cell. [antibody concentration 10 ug/ml])
IHC (Immunohistochemistry)
(Immunoperoxidase of monoclonal antibody to SMAD2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 5 ug/ml])
Application Data
(Immunoperoxidase of monoclonal antibody to SMAD2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 5 ug/ml])
Related Product Information for anti-SMAD2 antibody
The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signal of the transforming growth factor (TGF)-beta, and thus regulates multiple cellular processes, such as cell proliferation, apoptosis, and differentiation. This protein is recruited to the TGF-beta receptors through its interaction with the SMAD anchor for receptor activation (SARA) protein. In response to TGF-beta signal, this protein is phosphorylated by the TGF-beta receptors. The phosphorylation induces the dissociation of this protein with SARA and the association with the family member SMAD4. The association with SMAD4 is important for the translocation of this protein into the nucleus, where it binds to target promoters and forms a transcription repressor complex with other cofactors. This protein can also be phosphorylated by activin type 1 receptor kinase, and mediates the signal from the activin. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq]
Product Categories/Family for anti-SMAD2 antibody
References
1. Altered expression of p120catenin predicts poor outcome in invasive breast cancer. Talvinen K, Tuikkala J, Nykanen M, Nieminen A, Anttinen J, Nevalainen OS, Hurme S, Kuopio T, Kronqvist P.J Cancer Res Clin Oncol. 2010 Feb 12.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
SMAD family member 2
NCBI Official Synonym Full Names
SMAD family member 2
NCBI Official Symbol
SMAD2
NCBI Official Synonym Symbols
JV18; MADH2; MADR2; JV18-1; hMAD-2; hSMAD2
NCBI Protein Information
mothers against decapentaplegic homolog 2
