Rabbit Acetyl-Histone H1.4-K26 Polyclonal Antibody | anti-H1.4-K26 antibody

Acetyl-Histone H1.4-K26 Rabbit pAb

Cat. Num. AAA28437

• Gene Names: Trp53; bbl; bfy; bhy; p44; p53; Tp53
• Reactivity: Human, Mouse, Rat
• Applications: Immunohistochemistry, Immunofluorescence, Immunocytochemistry
• Purity: Affinity purification
• Synonyms: Acetyl-Histone H1.4-K26, Antibody; Acetyl-Histone H1.4-K26 Rabbit pAb; H1.4; H1E; H1F4; H1s-4; anti-H1.4-K26 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
• Sequence: PWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVL

• Applicable Applications for anti-H1.4-K26 antibody: Immunohistochemistry (IHC), Immunofluorescence (IF), Immunocytochemistry (ICC)
• Application Notes: IHC 1:50-1:200; IF/ICC: 1:50-1:200
• Immunogen: A synthetic acetylated peptide around K26 of human Histone H14 (NP_005312.1).
• Cellular Location: nucleus
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using Acetyl-Histone H1.4-K26 at dilution of 1:100. Blue: DAPI for nuclear staining.U2OS cells were treated by TSA (1 uM) at 37 degree C for 18 hours. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using Acetyl-Histone H1.4-K26 at dilution of 1:100. Blue: DAPI for nuclear staining.NIH/3T3 cells were treated by TSA (1 uM) at 37 degree C for 18 hours. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using Acetyl-Histone H1.4-K26 at dilution of 1:100. Blue: DAPI for nuclear staining.C6 cells were treated by TSA (1 uM) at 37 degree C for 18 hours. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse brain using Acetyl-Histone H1.4-K26 antibody at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human tonsil using Acetyl-Histone H1.4-K26 antibody at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat ovary using Acetyl-Histone H1.4-K26 antibody at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

Related Product Information for anti-H1.4-K26 antibody

Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H1 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq, Aug 2015]

Product Categories/Family for anti-H1.4-K26 antibody

Epigenetic Modifications; Epigenetic Modifications_Acetylation; Epigenetic Modifications_Methylation; Epigenetics & Nuclear Signaling; Histones; Acetylated Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 187960040
• NCBI GeneID: 22059
• NCBI Accession #: NP_001120705.1
• NCBI GenBank Nucleotide #: NM_001127233.1
• UniProt Accession #: P02340; Q9QUP3
• Molecular Weight: 44kDa
• NCBI Official Full Name: cellular tumor antigen p53 isoform b
• NCBI Official Synonym Full Names: transformation related protein 53
• NCBI Official Symbol: Trp53
• NCBI Official Synonym Symbols: bbl; bfy; bhy; p44; p53; Tp53
• NCBI Protein Information: cellular tumor antigen p53; p53 cellular tumor antigen; tumor suppressor p53; tumor supressor p53
• UniProt Protein Name: Cellular tumor antigen p53
• UniProt Gene Name: Tp53
• UniProt Synonym Gene Names: P53; Trp53
• UniProt Entry Name: P53_MOUSE