SDS-PAGE
Type-2 angiotensin II receptor Recombinant Protein | AGTR2 recombinant protein
Recombinant Human Type-2 angiotensin II receptor
Gene Names
AGTR2; AT2; ATGR2; MRX88
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Type-2 angiotensin II receptor; N/A; Recombinant Human Type-2 angiotensin II receptor; Angiotensin II type-2 receptor; AT2; AGTR2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-45aa; Partial
Sequence
MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLD
Sequence Length
45
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for AGTR2 recombinant protein
Receptor for angiotensin II. Cooperates with MTUS1 to inhibit ERK2 activation and cell proliferation.
Product Categories/Family for AGTR2 recombinant protein
References
"Assignment of the human angiotensin II type 2 receptor gene (AGTR2) to chromosome Xq22-q23 by fluorescence in situ hybridization." Chassagne C., Beatty B.G., Meloche S. Genomics 25:601-603(1995)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
20.8 kDa
NCBI Official Full Name
type-2 angiotensin II receptor
NCBI Official Synonym Full Names
angiotensin II receptor type 2
NCBI Official Symbol
AGTR2
NCBI Official Synonym Symbols
AT2; ATGR2; MRX88
NCBI Protein Information
type-2 angiotensin II receptor
UniProt Protein Name
Type-2 angiotensin II receptor
UniProt Gene Name
AGTR2
UniProt Synonym Gene Names
AT2
UniProt Entry Name
AGTR2_HUMAN
Similar Products
Product Notes
The AGTR2 agtr2 (Catalog #AAA81699) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-45aa; Partial. The amino acid sequence is listed below: MKGNSTLATT SKNITSGLHF GLVNISGNNE STLNCSQKPS DKHLD. It is sometimes possible for the material contained within the vial of "Type-2 angiotensin II receptor, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.