Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Acetylcholinesterase collagenic tail peptide (Colq) Recombinant Protein | Colq recombinant protein

Recombinant Mouse Acetylcholinesterase collagenic tail peptide (Colq)

Average rating 0.0
No ratings yet
Gene Names
Colq; A130034K24Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Acetylcholinesterase collagenic tail peptide (Colq); N/A; Recombinant Mouse Acetylcholinesterase collagenic tail peptide (Colq); Colq recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
30-457, Full length protein
Sequence
VVPISAALPGLDQKKRGSHKACCLLMPPPPPLFPPPFFRGSRSPLLSPDMKNLLELEASPSPCIQGSLGSPGPPGPQGPPGLPGKTGPKGEKGDLGRPGRKGRPGPPGVPGMPGPVGWPGPEGPRGEKGDLGMMGLPGSRGPMGSKGFPGSRGEKGSRGERGDLGPKGEKGFPGFPGMLGQKGEMGPKGESGLAGHRGPTGRPGKRGKQGQKGDSGIMGPPGKPGPSGQPGRQGPPGPPGPPSAGQLVMGLKGERGFPGPPGRCLCGPPVNVNNPSYGDSMYGRGSPRVPAIFVVNNQEELERLNTQNAIAFRRDQRSLYFKDSLGWLPIQLTPFYPVGYTVKQPGTCGDGVLQPGEECDDGNPDVSDGCIDCHRAYCGDGYRHQGVEDCDGSDFGYLTCETYLPGSYGDLRCTQYCSIDSTPCRYFT
Sequence Length
428
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Colq recombinant protein
This gene encodes the subunit of a collagen-like molecule associated with acetylcholinesterase in skeletal muscle. Each molecule is composed of three identical subunits. Each subunit contains a proline-rich attachment domain (PRAD) that binds an acetylcholinesterase tetramer to anchor the catalytic subunit of the enzyme to the basal lamina. Mutations in this gene are associated with endplate acetylcholinesterase deficiency. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,684 Da
NCBI Official Full Name
acetylcholinesterase collagenic tail peptide
NCBI Official Synonym Full Names
collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase
NCBI Official Symbol
Colq
NCBI Official Synonym Symbols
A130034K24Rik
NCBI Protein Information
acetylcholinesterase collagenic tail peptide
UniProt Protein Name
Acetylcholinesterase collagenic tail peptide
UniProt Gene Name
Colq

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Colq colq (Catalog #AAA115652) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 30-457, Full length protein. The amino acid sequence is listed below: VVPISAALPG LDQKKRGSHK ACCLLMPPPP PLFPPPFFRG SRSPLLSPDM KNLLELEASP SPCIQGSLGS PGPPGPQGPP GLPGKTGPKG EKGDLGRPGR KGRPGPPGVP GMPGPVGWPG PEGPRGEKGD LGMMGLPGSR GPMGSKGFPG SRGEKGSRGE RGDLGPKGEK GFPGFPGMLG QKGEMGPKGE SGLAGHRGPT GRPGKRGKQG QKGDSGIMGP PGKPGPSGQP GRQGPPGPPG PPSAGQLVMG LKGERGFPGP PGRCLCGPPV NVNNPSYGDS MYGRGSPRVP AIFVVNNQEE LERLNTQNAI AFRRDQRSLY FKDSLGWLPI QLTPFYPVGY TVKQPGTCGD GVLQPGEECD DGNPDVSDGC IDCHRAYCGD GYRHQGVEDC DGSDFGYLTC ETYLPGSYGD LRCTQYCSID STPCRYFT. It is sometimes possible for the material contained within the vial of "Acetylcholinesterase collagenic tail peptide (Colq), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.