Cathepsin S Recombinant Protein | ctss recombinant protein

Recombinant Mouse Cathepsin S

Cat. Num. AAA116020

• Gene Names: Ctss; Cats
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cathepsin S; N/A; Recombinant Mouse Cathepsin S; ctss recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 123-340aa; Full Length of Mature Protein
• Sequence: LPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for ctss recombinant protein

Thiol protease. Key protease responsible for the roval of the invariant chain from MHC class II molecules. The bond-specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N.

References

Doh-ura K. Rommerskirch W. Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Cathepsin expression during skeletal development.Soederstroem M., Salminen H., Glumoff V., Kirschke H., Aro H., Vuorio E.Biochim. Biophys. Acta 1446:35-46(1999) Gene expression in scrapie. Cloning of a new scrapie-responsive gene and the identification of increased levels of seven other mRNA transcripts.Dandoy-Dron F., Guillo F., Benboudjema L., Deslys J.-P., Lasmesas C., Dormont D., Tovey M.G., Dron M.J. Biol. Chem. 273:7691-7697(1998)

NCBI and Uniprot Product Information

• NCBI GI #: 510025483
• NCBI GeneID: 13040
• NCBI Accession #: NP_067256.4
• NCBI GenBank Nucleotide #: NM_021281.3
• UniProt Accession #: O70370; O54973; E9QK18
• Molecular Weight: 27.7 kDa
• NCBI Official Full Name: cathepsin S isoform 2 preproprotein
• NCBI Official Synonym Full Names: cathepsin S
• NCBI Official Symbol: Ctss
• NCBI Official Synonym Symbols: Cats
• NCBI Protein Information: cathepsin S
• UniProt Protein Name: Cathepsin S
• UniProt Gene Name: Ctss
• UniProt Synonym Gene Names: Cats
• UniProt Entry Name: CATS_MOUSE