Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA279371_SDS_PAGE13.jpg SDS-PAGE ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

ATCC 53516 LPXTG-motif cell wall anchor domain protein Active Protein | ATCC53516 active protein

Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial, Biotinylated (Active)

Purity
Greater than 95% as determined by SDS-PAGE.
Synonyms
ATCC 53516 LPXTG-motif cell wall anchor domain protein; N/A; Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial, Biotinylated (Active); ATCC53516 active protein
Ordering
Host
E Coli
Purity/Purification
Greater than 95% as determined by SDS-PAGE.
Form/Format
Lyophilized powder; Lyophilized from a 0.2um sterile filtered PBS, 6% Trehalose, pH 7.4
Sequence
KEETPETPETDSEEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADALKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADLLAKENGKYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFAEATAEAYRYADLLAKENGKYTADLEDGGYTINIRFAGKKVDEKPEEKEQVTIKENIYFEDGTVQTATFKGTFAEATAEAYRYADLLSKEHGKYTADLEDGGYTINIRFAG
Sequence Length
106-470aa; Partial
Species
Finegoldia magna ATCC 53516
Tag
N-terminal 10xHis-Avi-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized anti-CTLA4 antibody at 2ug/mL can bind Biotinylated Protein L. The EC50 is 1.123-1.761ng/mL.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

product-image-AAA279371_SDS_PAGE13.jpg SDS-PAGE ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Activity

product-image-AAA279371_ACTIVITY15.jpg Activity
References
Muzny D., Qin X., Buhay C., Dugan-Rocha S., Ding Y., Chen G., Hawes A., Holder M., Jhangiani S.Submitted to EMBL/GenBank/DDBJ databases (MAY-2010)

NCBI and Uniprot Product Information

UniProt Accession #
Molecular Weight
44.2kDa

Similar Products

Product Notes

The ATCC53516 (Catalog #AAA279371) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: KEETPETPET DSEEEVTIKA NLIFANGSTQ TAEFKGTFEK ATSEAYAYAD TLKKDNGEYT VDVADKGYTL NIKFAGKEKT PEEPKEEVTI KANLIYADGK TQTAEFKGTF EEATAEAYRY ADALKKDNGE YTVDVADKGY TLNIKFAGKE KTPEEPKEEV TIKANLIYAD GKTQTAEFKG TFEEATAEAY RYADLLAKEN GKYTVDVADK GYTLNIKFAG KEKTPEEPKE EVTIKANLIY ADGKTQTAEF KGTFAEATAE AYRYADLLAK ENGKYTADLE DGGYTINIRF AGKKVDEKPE EKEQVTIKEN IYFEDGTVQT ATFKGTFAEA TAEAYRYADL LSKEHGKYTA DLEDGGYTIN IRFAG. It is sometimes possible for the material contained within the vial of "ATCC 53516 LPXTG-motif cell wall anchor domain protein, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.