Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Growth/differentiation factor 9 (GDF9) Recombinant Protein | GDF9 recombinant protein

Recombinant Sheep Growth/differentiation factor 9 (GDF9)

Average rating 0.0
No ratings yet
Gene Names
GDF9; GDF-9
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Growth/differentiation factor 9 (GDF9); N/A; Recombinant Sheep Growth/differentiation factor 9 (GDF9); GDF9 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
319-453aa; Full Length of Mature Protein
Sequence
DQESASSELKKPLVPASVNLSEYFKQFLFPQNECELHDFRLSFSQLKWDNWIVAPHKYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIHEKLDSSVPRPSCVPAKYSPLSVLAIEPDGSIAYKEYEDMIATKCTCR
Species
Sheep
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for GDF9 recombinant protein
Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. Growth differentiation factor-9 (GDF9) is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9 is a member of the transforming growth factor-beta superfamily.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,776 Da
NCBI Official Full Name
growth/differentiation factor 9
NCBI Official Symbol
GDF9
NCBI Official Synonym Symbols
GDF-9
NCBI Protein Information
growth/differentiation factor 9
UniProt Protein Name
Growth/differentiation factor 9
UniProt Gene Name
GDF9
UniProt Synonym Gene Names
GDF-9

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GDF9 gdf9 (Catalog #AAA116006) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 319-453aa; Full Length of Mature Protein. The amino acid sequence is listed below: DQESASSELK KPLVPASVNL SEYFKQFLFP QNECELHDFR LSFSQLKWDN WIVAPHKYNP RYCKGDCPRA VGHRYGSPVH TMVQNIIHEK LDSSVPRPSC VPAKYSPLSV LAIEPDGSIA YKEYEDMIAT KCTCR. It is sometimes possible for the material contained within the vial of "Growth/differentiation factor 9 (GDF9), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.