IFN-alpha H2/IFNA14 Recombinant Protein | IFNA14 recombinant protein

Recombinant Human IFN-alpha H2/IFNA14 Protein

Cat. Num. AAA283387

• Purity: >95% by SDS-PAGE.
• Synonyms: IFN-alpha H2/IFNA14; N/A; Recombinant Human IFN-alpha H2/IFNA14 Protein; Interferon alpha-14, IFN-alpha-14, Interferon alpha-H, LeIF H, Interferon lambda-2-H, IFNA14; IFNA14 recombinant protein

• Host: HEK293 cells
• Purity/Purification: >95% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
• Sequence: CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD

• Species: Human
• Tag: C-His
• Endotoxin: <0.01EU/ug of the protein by LAL method.
• Bio-Activity: Measured in a cell cytotoxicity assay using TF-1 cells. The ED₅₀ for this effect is 0.47?1.88ng/mL, corresponding to a specific activity of 5.32×10⁵~2.13×10⁶ units/mg.
• Preparation and Storage: Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(Recombinant Human IFN-alpha H2/IFNA14 was measured in a cell cytotoxicity assay using TF-1 cells. The ED₅₀ for this effect is 0.47?1.88 ng/mL, corresponding to a specific activity of 5.32×10⁵~2.13×10⁶ units/mg.)

SDS-PAGE

(Recombinant Human IFN-alpha H2/IFNA14 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 20-30 kDa.)

Related Product Information for IFNA14 recombinant protein

Interferons (IFN) are a family of cytokines with potent antiviral, antiproliferative and immunomodulatory properties, classified based on their binding specificity to cell surface receptors. Human IFNA2 was originally cloned in the early '80s and now more than a dozen closely related IFN alpha subtypes have been identified in both the human and mouse genome, each sharing about 80% amino acid (aa) sequence homology. Structurally, type I IFNs belong to the class of five helicalbundle cytokines, with the IFNA subtypes containing 2 conserved disulfide bonds. The extracellular domain (ECD) of mature human IFNA14, shares 58% aa sequence identity with mouse IFNA14. The type I IFNs bind to the interferon alpha receptor (IFNAR), which consists of two subunits: IFNAR1 (alphasubunit) and IFNAR2 (beta-subunit). Individual IFNA subtypes are known to display unique efficacies to viral protection, and IFNA14 has been shown to be a strong inducer of IFN-stimulated genes and anti-viral protection. IFNA14 has been shown to be potent against HIV-1 by upregulating the transcription of two intrinsic restriction factors with well-established anti-HIV-1 activity, MX2 and tetherin.

Product Categories/Family for IFNA14 recombinant protein

Cytokines & Cytokine receptors; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 170763491
• NCBI GeneID: 3448
• NCBI Accession #: NP_002163.2
• NCBI GenBank Nucleotide #: NM_002172.2
• UniProt Accession #: P01570; Q5VZ56; Q7M4S1
• UniProt Protein Name: Interferon alpha-14
• UniProt Gene Name: IFNA14
• UniProt Synonym Gene Names: IFN-alpha-14; LeIF H
• UniProt Entry Name: IFN14_HUMAN