Mouse anti-Human ABCF2 Monoclonal Antibody | anti-ABCF2 antibody

ABCF2 (ATP-binding Cassette Sub-family F Member 2, Iron-inhibited ABC Transporter 2, HUSSY-18, DKFZp586K1823, EST133090, M-ABC1) (AP)

Cat. Num. AAA24115

• Gene Names: ABCF2; ABC28; HUSSY18; HUSSY-18; EST133090
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ABCF2, Antibody; ABCF2 (ATP-binding Cassette Sub-family F Member 2, Iron-inhibited ABC Transporter 2, HUSSY-18, DKFZp586K1823, EST133090, M-ABC1) (AP); anti-ABCF2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1D11
• Specificity: Recognizes human ABCF2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-ABCF2 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-110 from ABCF2 (AAH01661) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNS
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western blot analysis of ABCF2 over-expressed 293 cell line, cotransfected with ABCF2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ABCF2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged ABCF2 is ~0.3ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of ABCF2 transfected lysate using anti-ABCF2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ABCF2 monoclonal antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to ABCF2 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of ABCF2 expression in transfected 293T cell line by ABCF2 monoclonal antibody: Lane 1: ABCF2 transfected lysate (68.53kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(ABCF2 monoclonal antibody Western Blot analysis of ABCF2 expression in Hela.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.73kD).)

Product Categories/Family for anti-ABCF2 antibody

Antibodies; Multi Drug Resistance (MDR)

NCBI and Uniprot Product Information

• NCBI GI #: 33990716
• NCBI GeneID: 10061
• Molecular Weight: 72,444 Da
• NCBI Official Full Name: Homo sapiens ATP-binding cassette, sub-family F (GCN20), member 2, mRNA
• NCBI Official Synonym Full Names: ATP binding cassette subfamily F member 2
• NCBI Official Symbol: ABCF2
• NCBI Official Synonym Symbols: ABC28; HUSSY18; HUSSY-18; EST133090
• NCBI Protein Information: ATP-binding cassette sub-family F member 2