Loading...

Skip to main content
IHC (Immunohistochemistry) (Figure 8. IHC analysis of Aconitase 2 using anti-Aconitase 2 antibody (AAA19706).Aconitase 2 was detected in a paraffin-embedded section of rat heart tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Aconitase 2 Antibody (AAA19706) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

Mouse Aconitase 2 Monoclonal Antibody | anti-ACO2 antibody

Anti-Aconitase 2 Antibody Picoband (monoclonal, 4C12D1)

Gene Names
ACO2; ICRD; ACONM
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen affinity purified.
Synonyms
Aconitase 2, Antibody; Anti-Aconitase 2 Antibody Picoband (monoclonal, 4C12D1); anti-ACO2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
Mouse IgG1
Clone Number
4C12D1
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Concentration
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml. (varies by lot)
Applicable Applications for anti-ACO2 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 0.25-0.5 ug/ml, Human, Mouse, Rat
IHC-P: 2-5 ug/ml, Human, Mouse, Rat
Tested Species: In-house tested species with positive results.
Enhanced Chemiluminescent Kit with anti-Mouse IgG for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit for IHC(P).
Reconstitution
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Aconitase 2 (561-596aa TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH), identical to the related mouse and rat sequences.
Preparation and Storage
Store at -20 degree C for one year from date of receipt. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for six months. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Figure 8. IHC analysis of Aconitase 2 using anti-Aconitase 2 antibody (AAA19706).Aconitase 2 was detected in a paraffin-embedded section of rat heart tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Aconitase 2 Antibody (AAA19706) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry) (Figure 8. IHC analysis of Aconitase 2 using anti-Aconitase 2 antibody (AAA19706).Aconitase 2 was detected in a paraffin-embedded section of rat heart tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Aconitase 2 Antibody (AAA19706) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 7. IHC analysis of Aconitase 2 using anti-Aconitase 2 antibody (AAA19706).Aconitase 2 was detected in a paraffin-embedded section of mouse heart tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Aconitase 2 Antibody (AAA19706) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry) (Figure 7. IHC analysis of Aconitase 2 using anti-Aconitase 2 antibody (AAA19706).Aconitase 2 was detected in a paraffin-embedded section of mouse heart tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Aconitase 2 Antibody (AAA19706) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistchemistry)

(Figure 6. IHC analysis of Aconitase 2 using anti-Aconitase 2 antibody (AAA19706).Aconitase 2 was detected in a paraffin-embedded section of human testicular germ cell tumor tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Aconitase 2 Antibody (AAA19706) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistchemistry) (Figure 6. IHC analysis of Aconitase 2 using anti-Aconitase 2 antibody (AAA19706).Aconitase 2 was detected in a paraffin-embedded section of human testicular germ cell tumor tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Aconitase 2 Antibody (AAA19706) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 5. IHC analysis of Aconitase 2 using anti-Aconitase 2 antibody (AAA19706).Aconitase 2 was detected in a paraffin-embedded section of human lung adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Aconitase 2 Antibody (AAA19706) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry) (Figure 5. IHC analysis of Aconitase 2 using anti-Aconitase 2 antibody (AAA19706).Aconitase 2 was detected in a paraffin-embedded section of human lung adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Aconitase 2 Antibody (AAA19706) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 4. IHC analysis of Aconitase 2 using anti-Aconitase 2 antibody (AAA19706).Aconitase 2 was detected in a paraffin-embedded section of human laryngeal squamous cell carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Aconitase 2 Antibody (AAA19706) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry) (Figure 4. IHC analysis of Aconitase 2 using anti-Aconitase 2 antibody (AAA19706).Aconitase 2 was detected in a paraffin-embedded section of human laryngeal squamous cell carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Aconitase 2 Antibody (AAA19706) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 3. IHC analysis of Aconitase 2 using anti-Aconitase 2 antibody (AAA19706).Aconitase 2 was detected in a paraffin-embedded section of human hepatocellular carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Aconitase 2 Antibody (AAA19706) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry) (Figure 3. IHC analysis of Aconitase 2 using anti-Aconitase 2 antibody (AAA19706).Aconitase 2 was detected in a paraffin-embedded section of human hepatocellular carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Aconitase 2 Antibody (AAA19706) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 2. IHC analysis of Aconitase 2 using anti-Aconitase 2 antibody (AAA19706).Aconitase 2 was detected in a paraffin-embedded section of human breast cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Aconitase 2 Antibody (AAA19706) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry) (Figure 2. IHC analysis of Aconitase 2 using anti-Aconitase 2 antibody (AAA19706).Aconitase 2 was detected in a paraffin-embedded section of human breast cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Aconitase 2 Antibody (AAA19706) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of Aconitase 2 using anti-Aconitase 2 antibody (AAA19706).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Hela whole cell lysates,Lane 2: human U-87MG whole cell lysates,Lane 3: human Jurkat whole cell lysates,Lane 4: human SH-SY5Y whole cell lysates,Lane 5: rat skeletal muscle tissue lysates,Lane 6: rat brain tissue lysates,Lane 7: mouse skeletal muscle tissue lysates,Lane 8: mouse brain tissue lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-Aconitase 2 antigen affinity purified monoclonal antibody (#AAA19706) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Aconitase 2 at approximately 85 kDa. The expected band size for Aconitase 2 is at 85 kDa.)

WB (Western Blot) (Figure 1. Western blot analysis of Aconitase 2 using anti-Aconitase 2 antibody (AAA19706).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Hela whole cell lysates,Lane 2: human U-87MG whole cell lysates,Lane 3: human Jurkat whole cell lysates,Lane 4: human SH-SY5Y whole cell lysates,Lane 5: rat skeletal muscle tissue lysates,Lane 6: rat brain tissue lysates,Lane 7: mouse skeletal muscle tissue lysates,Lane 8: mouse brain tissue lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-Aconitase 2 antigen affinity purified monoclonal antibody (#AAA19706) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Aconitase 2 at approximately 85 kDa. The expected band size for Aconitase 2 is at 85 kDa.)
Related Product Information for anti-ACO2 antibody
Aconitase 2, mitochondrial is a protein that in humans is encoded by the ACO2 gene. The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.
Product Categories/Family for anti-ACO2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
50
UniProt Accession #
Molecular Weight
780
NCBI Official Full Name
Aconitate hydratase, mitochondrial
NCBI Official Synonym Full Names
aconitase 2, mitochondrial
NCBI Official Symbol
ACO2
NCBI Official Synonym Symbols
ICRD; ACONM
NCBI Protein Information
aconitate hydratase, mitochondrial; citrate hydro-lyase
UniProt Protein Name
Aconitate hydratase, mitochondrial
UniProt Gene Name
ACO2
UniProt Synonym Gene Names
Aconitase
UniProt Entry Name
ACON_HUMAN

Similar Products

Product Notes

The ACO2 aco2 (Catalog #AAA19706) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-Aconitase 2 Antibody Picoband (monoclonal, 4C12D1) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Aconitase 2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 0.25-0.5 ug/ml, Human, Mouse, Rat IHC-P: 2-5 ug/ml, Human, Mouse, Rat Tested Species: In-house tested species with positive results. Enhanced Chemiluminescent Kit with anti-Mouse IgG for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit for IHC(P). Researchers should empirically determine the suitability of the ACO2 aco2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Aconitase 2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.