Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24709_WB7.jpg WB (Western Blot) (ACP1 monoclonal antibody Western Blot analysis of ACP1 expression in NIH/3T3.)

Mouse ACP1 Monoclonal Antibody | anti-ACP1 antibody

ACP1 (Low Molecular Weight Phosphotyrosine Protein Phosphatase, LMW-PTP, LMW-PTPase, Low Molecular Weight Cytosolic Acid Phosphatase, Red Cell Acid Phosphatase 1, PTPase, Adipocyte Acid Phosphatase) (Biotin)

Gene Names
ACP1; HAAP; LMW-PTP
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ACP1, Antibody; ACP1 (Low Molecular Weight Phosphotyrosine Protein Phosphatase, LMW-PTP, LMW-PTPase, Low Molecular Weight Cytosolic Acid Phosphatase, Red Cell Acid Phosphatase 1, PTPase, Adipocyte Acid Phosphatase) (Biotin); anti-ACP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4B10
Specificity
Recognizes human ACP1. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ACP1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-158 from human ACP1 (AAH07422) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(ACP1 monoclonal antibody Western Blot analysis of ACP1 expression in NIH/3T3.)

product-image-AAA24709_WB7.jpg WB (Western Blot) (ACP1 monoclonal antibody Western Blot analysis of ACP1 expression in NIH/3T3.)

WB (Western Blot)

(ACP1 monoclonal antibody Western Blot analysis of ACP1 expression in PC-12.)

product-image-AAA24709_WB6.jpg WB (Western Blot) (ACP1 monoclonal antibody Western Blot analysis of ACP1 expression in PC-12.)

Application Data

(Detection limit for recombinant GST tagged ACP1 is ~3ng/ml as a capture antibody.)

product-image-AAA24709_APP5.jpg Application Data (Detection limit for recombinant GST tagged ACP1 is ~3ng/ml as a capture antibody.)

WB (Western Blot)

(Western Blot analysis of ACP1 expression in transfected 293T cell line by ACP1 monoclonal antibody. Lane 1: ACP1 transfected lysate (18kD). Lane 2: Non-transfected lysate.)

product-image-AAA24709_WB4.jpg WB (Western Blot) (Western Blot analysis of ACP1 expression in transfected 293T cell line by ACP1 monoclonal antibody. Lane 1: ACP1 transfected lysate (18kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(ACP1 monoclonal antibody Western Blot analysis of ACP1 expression in Raw 264.7.)

product-image-AAA24709_WB3.jpg WB (Western Blot) (ACP1 monoclonal antibody Western Blot analysis of ACP1 expression in Raw 264.7.)

WB (Western Blot)

(ACP1 monoclonal antibody Western Blot analysis of ACP1 expression in HeLa.)

product-image-AAA24709_WB2.jpg WB (Western Blot) (ACP1 monoclonal antibody Western Blot analysis of ACP1 expression in HeLa.)

WB (Western Blot)

(Western Blot detection against Immunogen (43.12kD).)

product-image-AAA24709_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (43.12kD).)
Related Product Information for anti-ACP1 antibody
Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity.
Product Categories/Family for anti-ACP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
52
Molecular Weight
12,230 Da
NCBI Official Full Name
Homo sapiens acid phosphatase 1, soluble, mRNA
NCBI Official Synonym Full Names
acid phosphatase 1, soluble
NCBI Official Symbol
ACP1
NCBI Official Synonym Symbols
HAAP; LMW-PTP
NCBI Protein Information
low molecular weight phosphotyrosine protein phosphatase

Similar Products

Product Notes

The ACP1 (Catalog #AAA24709) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ACP1 (Low Molecular Weight Phosphotyrosine Protein Phosphatase, LMW-PTP, LMW-PTPase, Low Molecular Weight Cytosolic Acid Phosphatase, Red Cell Acid Phosphatase 1, PTPase, Adipocyte Acid Phosphatase) (Biotin) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ACP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACP1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.