Mouse anti-Human AKR1B10 Monoclonal Antibody | anti-AKR1B10 antibody

AKR1B10 (Aldo-keto Reductase Family 1 Member B10, ARL-1, Aldose Reductase-like, Aldose Reductase-related Protein, ARP, hARP, Small Intestine Reductase, SI Reductase, AKR1B11) (AP)

Cat. Num. AAA24133

• Gene Names: AKR1B10; HIS; HSI; ARL1; ARL-1; ALDRLn; AKR1B11; AKR1B12
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: AKR1B10, Antibody; AKR1B10 (Aldo-keto Reductase Family 1 Member B10, ARL-1, Aldose Reductase-like, Aldose Reductase-related Protein, ARP, hARP, Small Intestine Reductase, SI Reductase, AKR1B11) (AP); anti-AKR1B10 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1A6
• Specificity: Recognizes human AKR1B10.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-AKR1B10 antibody: ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa76-144 from human AKR1B10 (NP_064695) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWE
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western Blot detection against Immunogen (33.59kD).)

Product Categories/Family for anti-AKR1B10 antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 223468663
• NCBI GeneID: 57016
• NCBI Accession #: NP_064695
• NCBI GenBank Nucleotide #: NM_020299
• UniProt Accession #: O60218; O75890; Q6FHF3; Q8IWZ1; A4D1P1
• Molecular Weight: 36 kDa (316aa), confirmed by MALDI-TOF.
• NCBI Official Full Name: aldo-keto reductase family 1 member B10
• NCBI Official Synonym Full Names: aldo-keto reductase family 1 member B10
• NCBI Official Symbol: AKR1B10
• NCBI Official Synonym Symbols: HIS; HSI; ARL1; ARL-1; ALDRLn; AKR1B11; AKR1B12
• NCBI Protein Information: aldo-keto reductase family 1 member B10
• UniProt Protein Name: Aldo-keto reductase family 1 member B10
• UniProt Gene Name: AKR1B10
• UniProt Synonym Gene Names: AKR1B11; ARP; hARP
• UniProt Entry Name: AK1BA_HUMAN