WB (Western Blot)
(Western Blot detection against immunogen using AAA26691 (36.41kD).)
Mouse anti-Human ATP2B1 Monoclonal Antibody | anti-ATP2B1 antibody
ATP2B1 (Plasma Membrane Calcium-transporting ATPase 1, PMCA1, Plasma Membrane Calcium ATPase Isoform 1, Plasma Membrane Calcium Pump Isoform 1, PMCA1) (MaxLight 550)
Gene Names
ATP2B1; PMCA1; PMCA1kb
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ATP2B1, Antibody; ATP2B1 (Plasma Membrane Calcium-transporting ATPase 1, PMCA1, Plasma Membrane Calcium ATPase Isoform 1, Plasma Membrane Calcium Pump Isoform 1, PMCA1) (MaxLight 550); anti-ATP2B1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E2
Specificity
Recognizes human ATP2B1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Concentration
0.95mg/mL (varies by lot)
Sequence
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKT
Sequence Length
1220
Applicable Applications for anti-ATP2B1 antibody
FLISA, Western Blot (WB) , Other applications not tested.
Application Notes
Optimal dilutions to be determined by the researcher.
Applications are based on unconjugated antibody
Applications are based on unconjugated antibody
Immunogen
Partial recombinant protein corresponding to aa1-97 from human ATP2B1 with GST tag. MW of the GST tag alone is 26kD.
Conjugate
MaxLight550
Note
Light sensitive
Preparation and Storage
Store product at 4 degrees C in the dark. DO NOT FREEZE! Stable at 4 degrees C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
WB (Western Blot)
(Western Blot detection against immunogen using AAA26691 (36.41kD).)
WB (Western Blot)
(Western Blot detection against immunogen using AAA26691 (36.41kD).)
FLISA
(Detection limit recombinant GST tagged ATP2B1 is ~0.3ng/mL using AAA26691 as a capture antibody.)
FLISA
(Detection limit recombinant GST tagged ATP2B1 is ~0.3ng/mL using AAA26691 as a capture antibody.)
Related Product Information for anti-ATP2B1 antibody
MaxLight550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor546, 555, DyLight549 , Cy3, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
Calcium-transporting ATPase belongs to the cation transport ATPase (P-type) family and plays a critical role in intracellular calcium homeostasis. Mammalian Calcium-transporting ATPases are encoded by at least four separate genes with multiple isoforms produced by alternative splicing.
Calcium-transporting ATPase belongs to the cation transport ATPase (P-type) family and plays a critical role in intracellular calcium homeostasis. Mammalian Calcium-transporting ATPases are encoded by at least four separate genes with multiple isoforms produced by alternative splicing.
Product Categories/Family for anti-ATP2B1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
plasma membrane calcium-transporting ATPase 1 isoform 1b
NCBI Official Synonym Full Names
ATPase plasma membrane Ca2+ transporting 1
NCBI Official Symbol
ATP2B1
NCBI Official Synonym Symbols
PMCA1; PMCA1kb
NCBI Protein Information
plasma membrane calcium-transporting ATPase 1
UniProt Protein Name
Plasma membrane calcium-transporting ATPase 1
UniProt Gene Name
ATP2B1
UniProt Synonym Gene Names
PMCA1
UniProt Entry Name
AT2B1_HUMAN
Similar Products
Product Notes
The ATP2B1 atp2b1 (Catalog #AAA26691) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ATP2B1 (Plasma Membrane Calcium-transporting ATPase 1, PMCA1, Plasma Membrane Calcium ATPase Isoform 1, Plasma Membrane Calcium Pump Isoform 1, PMCA1) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP2B1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB), Other applications not tested. Optimal dilutions to be determined by the researcher. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATP2B1 atp2b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGDMANNSVA YSGVKNSLKE ANHDGDFGIT LAELRALMEL RSTDALRKIQ ESYGDVYGIC TKLKTSPNEG LSGNPADLER REAVFGKNFI PPKKPKT. It is sometimes possible for the material contained within the vial of "ATP2B1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
