Mouse anti-Human, Mouse CDADC1 Monoclonal Antibody | anti-CDADC1 antibody

CDADC1 (Cytidine and dCMP Deaminase Domain-containing Protein 1, Testis Development Protein NYD-SP15, MGC150615, MGC41774, MGC57136, NYD-SP15, BA103J18.1)

Cat. Num. AAA24102

• Gene Names: CDADC1; NYD-SP15; bA103J18.1; RP11-103J18.2
• Reactivity: Human, Mouse
• Applications: ELISA, Western Blot, Immunohistochemistry
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: CDADC1, Antibody; CDADC1 (Cytidine and dCMP Deaminase Domain-containing Protein 1, Testis Development Protein NYD-SP15, MGC150615, MGC41774, MGC57136, NYD-SP15, BA103J18.1); Anti -CDADC1 (Cytidine and dCMP Deaminase Domain-containing Protein 1, Testis Development Protein NYD-SP15, MGC150615, MGC41774, MGC57136, NYD-SP15, BA103J18.1); anti-CDADC1 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1A2
• Specificity: Recognizes human CDADC1. Species Crossreactivity: mouse.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: KCPCDECVPLIKGAGIKQIYAGDVDVGKKKADISYMRFGELEGVSKFTWQLNPSGAYGLEQNEPERRENGVLRPVPQKEEQHQDKKLRLGIH

• Applicable Applications for anti-CDADC1 antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
• Application Notes: Suitable for use in ELISA, Western Blot and Immunohistochemistry.; Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml
• Immunogen: Partial recombinant corresponding to aa423-515 from human CDADC1 (NP_112173) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(CDADC1 monoclonal antibody. Western Blot analysis of CDADC1 expression in NIH/3T3.)

WB (Western Blot)

(CDADC1 monoclonal antibody. Western Blot analysis of CDADC1 expression in Raw 264.7.)

WB (Western Blot)

(Western blot analysis of CDADC1 over-expressed 293 cell line, cotransfected with CDADC1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CDADC1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged CDADC1 is ~0.03ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to CDADC1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1ug/ml].)

WB (Western Blot)

(Western Blot analysis of CDADC1 expression in transfected 293T cell line by CDADC1 monoclonal antibody.Lane 1: CDADC1 transfected lysate (58.5kD).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.23kD).)

Related Product Information for anti-CDADC1 antibody

CDADC1 may play an important role in testicular development and spermatogenesis.

Product Categories/Family for anti-CDADC1 antibody

Antibodies; Abs to Enzymes; Cytidine Deaminase (APOBEC)

NCBI and Uniprot Product Information

• NCBI GI #: 71297353
• NCBI GeneID: 81602
• UniProt Accession #: Q9BWV3; Q49A08; Q4G119; Q5TAW9; Q7Z764; Q9NT36
• Molecular Weight: 58,455 Da
• NCBI Official Full Name: CDADC1 protein
• NCBI Official Synonym Full Names: cytidine and dCMP deaminase domain containing 1
• NCBI Official Symbol: CDADC1
• NCBI Official Synonym Symbols: NYD-SP15; bA103J18.1; RP11-103J18.2
• NCBI Protein Information: cytidine and dCMP deaminase domain-containing protein 1; protein kinase NYD-SP15; testis development protein NYD-SP15
• UniProt Protein Name: Cytidine and dCMP deaminase domain-containing protein 1
• UniProt Gene Name: CDADC1
• UniProt Entry Name: CDAC1_HUMAN