Loading...

Skip to main content

Mouse CDX4 Monoclonal Antibody | anti-CDX4 antibody

CDX4 (Homeobox Protein CDX-4, Caudal-type Homeobox Protein 4) APC

Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDX4, Antibody; CDX4 (Homeobox Protein CDX-4, Caudal-type Homeobox Protein 4) APC; anti-CDX4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3F3
Specificity
Recognizes human CDX4. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CDX4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa71-170 from human CDX4 (NP_005184.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVTGKT
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CDX4 antibody
Caudal type homeo box transcription factor 4 (CDX4) is a member of the caudal-type homeobox genes which are candidates for directing tissue and organ development and differentiation. CDX1 and CDX2 expression is widely present in the human intestinal and colonic mucosae, but not in the gastric mucosa, suggesting a possible role in the terminal differentiation of the intestine. CDX4 is located within the minimal region assigned to XIC in humans and furthermore, CDX4 is the closest known gene to XIST in both mouse and human. Unlike Xist, CDX4 appears to be normally X-inactivated in mice and it is not clear yet whether the location of this gene within the XIC region is of any significance in X-inactivation.
Product Categories/Family for anti-CDX4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,480 Da
NCBI Official Full Name
homeobox protein CDX-4
NCBI Official Synonym Full Names
caudal type homeobox 4
NCBI Official Symbol
CDX4
NCBI Protein Information
homeobox protein CDX-4; caudal-type homeobox protein 4; caudal type homeobox transcription factor 4
UniProt Protein Name
Homeobox protein CDX-4
UniProt Gene Name
CDX4
UniProt Entry Name
CDX4_HUMAN

Similar Products

Product Notes

The CDX4 cdx4 (Catalog #AAA24463) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDX4 (Homeobox Protein CDX-4, Caudal-type Homeobox Protein 4) APC reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CDX4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDX4 cdx4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDX4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.