Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24176_WB7.jpg WB (Western Blot) (Western blot analysis of CRKL over-expressed 293 cell line, cotransfected with CRKL Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CRKL monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Mouse anti-Human CRKL Monoclonal Antibody | anti-CRKL antibody

CRKL (Crk-like Protein) (AP)

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CRKL, Antibody; CRKL (Crk-like Protein) (AP); anti-CRKL antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4B5
Specificity
Recognizes human CRKL.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CRKL antibody
ELISA, WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa204-303 from human CRKL (NP_005198) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENE
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western blot analysis of CRKL over-expressed 293 cell line, cotransfected with CRKL Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CRKL monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

product-image-AAA24176_WB7.jpg WB (Western Blot) (Western blot analysis of CRKL over-expressed 293 cell line, cotransfected with CRKL Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CRKL monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

WB (Western Blot)

(Western Blot analysis of CRKL expression in transfected 293T cell line by CRKL monoclonal antibody. Lane 1: CRKL transfected lysate (33.8kD). Lane 2: Non-transfected lysate.)

product-image-AAA24176_WB6.jpg WB (Western Blot) (Western Blot analysis of CRKL expression in transfected 293T cell line by CRKL monoclonal antibody. Lane 1: CRKL transfected lysate (33.8kD). Lane 2: Non-transfected lysate.)

Application Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between PTK2 and CRKL. Huh7 cells were stained with PTK2 rabbit purified polyclonal 1:600 and CRKL mouse monoclonal antibody 1:100. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex)

product-image-AAA24176_APP5.jpg Application Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between PTK2 and CRKL. Huh7 cells were stained with PTK2 rabbit purified polyclonal 1:600 and CRKL mouse monoclonal antibody 1:100. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex)

Application Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between GAB1 and CRKL. HeLa cells were stained with GAB1 rabbit purified polyclonal 1:1200 and CRKL mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

product-image-AAA24176_APP4.jpg Application Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between GAB1 and CRKL. HeLa cells were stained with GAB1 rabbit purified polyclonal 1:1200 and CRKL mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Application Data

(Detection limit for recombinant GST tagged CRKL is ~0.3ng/ml as a capture antibody.)

product-image-AAA24176_APP3.jpg Application Data (Detection limit for recombinant GST tagged CRKL is ~0.3ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to CRKL on HeLa cell. [antibody concentration 10ug/ml].)

product-image-AAA24176_IF2.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to CRKL on HeLa cell. [antibody concentration 10ug/ml].)

WB (Western Blot)

(Western Blot detection against Immunogen (36.74kD).)

product-image-AAA24176_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (36.74kD).)
Product Categories/Family for anti-CRKL antibody
References
1. PI3K Links NKG2D Signaling to a CrkL Pathway Involved in Natural Killer Cell Adhesion, Polarity, and Granule Secretion. Segovis CM, Schoon RA, Dick CJ, Nacusi LP, Leibson PJ, Billadeau DD.J Immunol. 2009 Jun 1;182(11):6933-42.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35.9 kDa (323aa), confirmed by MALDI-TOF
NCBI Official Full Name
crk-like protein
NCBI Official Synonym Full Names
CRK like proto-oncogene, adaptor protein
NCBI Official Symbol
CRKL
NCBI Protein Information
crk-like protein
UniProt Protein Name
Crk-like protein
UniProt Gene Name
CRKL
UniProt Entry Name
CRKL_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CRKL crkl (Catalog #AAA24176) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CRKL (Crk-like Protein) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CRKL can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CRKL crkl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CRKL, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.