Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA26119_WB6.jpg WB (Western Blot) (Western Blot analysis of GAPDH expression in transfected 293T cell line by GAPDH monoclonal antibody (M01), clone 3C2.Lane 1: GAPDH transfected lysate(36.1 KDa).Lane 2: Non-transfected lysate.)

Mouse GAPDH Monoclonal Antibody | anti-GAPDH antibody

GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase, G3PD, GAPD, MGC88685) (APC)

Gene Names
GAPDH; G3PD; GAPD; HEL-S-162eP
Applications
Western Blot
Purity
Purified
Synonyms
GAPDH, Antibody; GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase, G3PD, GAPD, MGC88685) (APC); Glyceraldehyde-3-Phosphate Dehydrogenase; G3PD; GAPD; MGC88685; anti-GAPDH antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C2
Specificity
Recognizes GAPDH.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-GAPDH antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GAPDH (NP_002037, 226aa-335aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of GAPDH expression in transfected 293T cell line by GAPDH monoclonal antibody (M01), clone 3C2.Lane 1: GAPDH transfected lysate(36.1 KDa).Lane 2: Non-transfected lysate.)

product-image-AAA26119_WB6.jpg WB (Western Blot) (Western Blot analysis of GAPDH expression in transfected 293T cell line by GAPDH monoclonal antibody (M01), clone 3C2.Lane 1: GAPDH transfected lysate(36.1 KDa).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(GAPDH monoclonal antibody (M01), clone 3C2. Western Blot analysis of GAPDH expression in Raw 264.7.)

product-image-AAA26119_WB5.jpg WB (Western Blot) (GAPDH monoclonal antibody (M01), clone 3C2. Western Blot analysis of GAPDH expression in Raw 264.7.)

WB (Western Blot)

(GAPDH monoclonal antibody (M01), clone 3C2. Western Blot analysis of GAPDH expression in PC-12.)

product-image-AAA26119_WB4.jpg WB (Western Blot) (GAPDH monoclonal antibody (M01), clone 3C2. Western Blot analysis of GAPDH expression in PC-12.)

WB (Western Blot)

(GAPDH monoclonal antibody (M01), clone 3C2. Western Blot analysis of GAPDH expression in NIH/3T3.)

product-image-AAA26119_WB3.jpg WB (Western Blot) (GAPDH monoclonal antibody (M01), clone 3C2. Western Blot analysis of GAPDH expression in NIH/3T3.)

WB (Western Blot)

(GAPDH monoclonal antibody (M01), clone 3C2. Western Blot analysis of GAPDH expression in HeLa.)

product-image-AAA26119_WB2.jpg WB (Western Blot) (GAPDH monoclonal antibody (M01), clone 3C2. Western Blot analysis of GAPDH expression in HeLa.)

WB (Western Blot)

(GAPDH monoclonal antibody (M01), clone 3C2 Western Blot analysis of GAPDH expression in A-431.)

product-image-AAA26119_WB.jpg WB (Western Blot) (GAPDH monoclonal antibody (M01), clone 3C2 Western Blot analysis of GAPDH expression in A-431.)
Related Product Information for anti-GAPDH antibody
The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome. [provided by RefSeq]
Product Categories/Family for anti-GAPDH antibody
References
1. Reticulon 3 interacts with NS4B of the hepatitis C virus and negatively regulates viral replication by disrupting NS4B self-interaction.Wu MJ, Ke PY, Hsu JT, Yeh CT, Horng JTCell Microbiol. 2014 Jun 4. doi: 10.1111/cmi.12318. 2.Receptor for Activated Protein Kinase C: Requirement for Efficient MicroRNA Function and Reduced Expression in Hepatocellular Carcinoma. Otsuka M, Takata A, Yoshikawa T, Kojima K, Kishikawa T, Shibata C, Takekawa M, Yoshida H, Omata M, Koike K.PLoS One. 2011;6(9):e24359. Epub 2011 Sep 15. 3.Expression and roles of Slit/Robo in human ovarian cancer. Dai CF, Jiang YZ, Li Y, Wang K, Liu PS, Patankar MS, Zheng J.Histochem Cell Biol. 2011 Apr 5. 4. Anti-angiogenic effect of triterpenoidal saponins from Polygala senega. Arai M, Hayashi A, Sobou M, Ishida S, Kawachi T, Kotoku N, Kobayashi M.J Nat Med. 2010 Nov 2. 5. The Effect of Allelic Variation in Aldo-Keto Reductase 1C2 on the In Vitro Metabolism of Dihydrotestosterone. Takahashi RH, Grigliatti TA, Reid RE, Riggs KW.J Pharmacol Exp Ther. 2009 Jun;329(3):1032-9. Epub 2009 Mar 3.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 37 kDa

Observed: 36 kDa
NCBI Official Full Name
glyceraldehyde-3-phosphate dehydrogenase isoform 1
NCBI Official Synonym Full Names
glyceraldehyde-3-phosphate dehydrogenase
NCBI Official Symbol
GAPDH
NCBI Official Synonym Symbols
G3PD; GAPD; HEL-S-162eP
NCBI Protein Information
glyceraldehyde-3-phosphate dehydrogenase; aging-associated gene 9 protein; peptidyl-cysteine S-nitrosylase GAPDH; epididymis secretory sperm binding protein Li 162eP
UniProt Protein Name
Glyceraldehyde-3-phosphate dehydrogenase
UniProt Gene Name
GAPDH
UniProt Synonym Gene Names
GAPD; GAPDH
UniProt Entry Name
G3P_HUMAN

Similar Products

Product Notes

The GAPDH gapdh (Catalog #AAA26119) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GAPDH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GAPDH gapdh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GAPDH, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.