Rabbit anti-Human GLDC Monoclonal Antibody | anti-GLDC antibody

GLDC Rabbit PolymAb

Cat. Num. AAA28583

• Reactivity: Human
• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, ELISA
• Purity: Affinity purification
• Synonyms: GLDC, Antibody; GLDC Rabbit PolymAb; GCE; GCSP; HYGN1; anti-GLDC antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
• Sequence: HPFVPLDQAQGYQQLFRELEKDLCELTGYDQVCFQPNSGAQGEYAGLATIRAYLNQKGEGHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDKYGNIDAVHLKAMVDKHKENLAAIMITYPSTNGVFEENISDVCDLIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSH

• Applicable Applications for anti-GLDC antibody: Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), ELISA (EIA)
• Application Notes: WB: 1:25000-1:150000; IHC-P: 1:4000-1:16000; IF/ICC: 1:2000-1:8000; ELISA: Recommended starting concentration is 1ug/mL.; Please optimize the concentration based on your specific assay requirements.
• Cross Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 580-749 of human GLDC (NP_000161.2).
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

ICC (Immunocytochemistry)

(Confocal imaging of C6 cells using GLDC Rabbit PolymAb® (AAA28583, dilution 1:2000) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

ICC (Immunocytochemistry)

(Confocal imaging of NIH/3T3 cells using GLDC Rabbit PolymAb® (AAA28583, dilution 1:2000) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

ICC (Immunocytochemistry)

(Confocal imaging of Hep G2 cells using GLDC Rabbit PolymAb® (AAA28583, dilution 1:2000) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using GLDC Rabbit PolymAb® (AAA28583) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using GLDC Rabbit PolymAb® (AAA28583) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human liver tissue using GLDC Rabbit PolymAb® (AAA28583) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using GLDC Rabbit PolymAb® (AAA28583) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using GLDC Rabbit PolymAb® (AAA28583) at 1:25000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Related Product Information for anti-GLDC antibody

Degradation of glycine is brought about by the glycine cleavage system, which is composed of four mitochondrial protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). The protein encoded by this gene is the P protein, which binds to glycine and enables the methylamine group from glycine to be transferred to the T protein. Defects in this gene are a cause of nonketotic hyperglycinemia (NKH).

Product Categories/Family for anti-GLDC antibody

Cancer; Signal Transduction; Endocrine Metabolism; Mitochondrial metabolism; Mitochondrial markers; Amino acid metabolism; Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 108773801
• NCBI GeneID: 2731
• NCBI Accession #: NP_000161
• NCBI GenBank Nucleotide #: NM_000170
• UniProt Accession #: P23378; Q2M2F8
• Molecular Weight: Calculated MW: 113kDa; Observed MW: 113kDa
• UniProt Protein Name: Glycine dehydrogenase (decarboxylating), mitochondrial
• UniProt Gene Name: GLDC
• UniProt Synonym Gene Names: GCSP
• UniProt Entry Name: GCSP_HUMAN