Loading...

Skip to main content
WB (Western Blot) (Western Blot detection against Immunogen using (AAA25718) (37kD).)

Mouse anti-Human HPSE Monoclonal Antibody | anti-HPSE antibody

HPSE (Heparanase, Endo-glucoronidase, Heparanase-1, Hpa1, HEP, HPA, HPA1, HPR1, HPSE1, HSE1) (PE)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HPSE, Antibody; HPSE (Heparanase, Endo-glucoronidase, Heparanase-1, Hpa1, HEP, HPA, HPA1, HPR1, HPSE1, HSE1) (PE); anti-HPSE antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4D7
Specificity
Recognizes human HPSE.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Concentration
1mg/mL (varies by lot)
Sequence
LILLGSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKESTFEERSY
WQSQVNQDICKYGSIPPDVEEKLRLEWPYQEQLLLREHYQKKFKNSTYSRSSV
Sequence Length
543
Applicable Applications for anti-HPSE antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Other applications not tested

Optimal dilutions to be determined by the researcher.
Immunogen
Partial recombinant corresponding to aa72-170 from human HPSE (NP_006656) with GST tag. MW of the GST tag alone is 26kD.
Grade
Affinity purified
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer

Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western Blot detection against Immunogen using (AAA25718) (37kD).)

WB (Western Blot) (Western Blot detection against Immunogen using (AAA25718) (37kD).)

Application Data

(Detection limit for recombinant GST tagged HPSE is ~0.3ng/ml using (AAA25718) as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged HPSE is ~0.3ng/ml using (AAA25718) as a capture antibody.)
Related Product Information for anti-HPSE antibody
Endoglycosidase that cleaves heparan sulfate proteoglycans (HSPGs) into heparan sulfate side chains and core proteoglycans. Participates in extracellular matrix (ECM) degradation and remodeling. Selectively cleaves the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying either a 3-O-sulfo or a 6-O-sulfo group. Can also cleave the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying a 2-O-sulfo group, but not linkages between a glucuronic acid unit and a 2-O-sulfated iduronic acid moiety. It is essentially inactive at neutral pH but becomes active under acidic conditions such as during tumor invasion and in inflammatory processes. Facilitates cell migration associated with metastasis, wound healing and inflammation. Enhances shedding of syndecans, and increases endothelial invasion and angiogenesis in myelomas. Acts as procoagulant by increasing the generation of activation factor X in the presence of tissue factor and activation factor VII. Increases cell adhesion to the extacellular matrix (ECM), independent of its enzymatic activity. Induces AKT1/PKB phosphorylation via lipid rafts increasing cell mobility and invasion. Heparin increases this AKT1/PKB activation. Regulates osteogenesis. Enhances angiogenesis through up-regulation of SRC-mediated activation of VEGF. Implicated in hair follicle inner root sheath differentiation and hair homeostasis.
Product Categories/Family for anti-HPSE antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
heparanase

Similar Products

Product Notes

The HPSE (Catalog #AAA25718) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HPSE (Heparanase, Endo-glucoronidase, Heparanase-1, Hpa1, HEP, HPA, HPA1, HPR1, HPSE1, HSE1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HPSE can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Other applications not tested Optimal dilutions to be determined by the researcher. Researchers should empirically determine the suitability of the HPSE for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LILLGSPKLR TLARGLSPAY LRFGGTKTDF LIFDPKKEST FEERSY WQSQVNQDIC KYGSIPPDVE EKLRLEWPYQ EQLLLREHYQ KKFKNSTYSR SSV. It is sometimes possible for the material contained within the vial of "HPSE, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.