Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25428_WB6.jpg WB (Western Blot) (IL20 monoclonal antibody, Western Blot analysis of IL20 expression in K-562.)

Mouse anti-Human Interleukin 20 Monoclonal Antibody | anti-IL-20 antibody

Interleukin 20 (Interleukin-20, IL-20, IL20, Cytokine Zcyto10, IL10D, MGC96907, UNQ852/PRO1801, ZCYTO10) (HRP)

Gene Names
IL20; IL-20; IL10D; ZCYTO10
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Interleukin 20, Antibody; Interleukin 20 (Interleukin-20, IL-20, IL20, Cytokine Zcyto10, IL10D, MGC96907, UNQ852/PRO1801, ZCYTO10) (HRP); anti-IL-20 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2H8
Specificity
Recognizes human IL20.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
176
Applicable Applications for anti-IL-20 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa67-177 from human IL20 (NP_061194) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(IL20 monoclonal antibody, Western Blot analysis of IL20 expression in K-562.)

product-image-AAA25428_WB6.jpg WB (Western Blot) (IL20 monoclonal antibody, Western Blot analysis of IL20 expression in K-562.)

Application Data

(Detection limit for recombinant GST tagged IL20 is ~0.3ng/ml as a capture antibody.)

product-image-AAA25428_APP5.jpg Application Data (Detection limit for recombinant GST tagged IL20 is ~0.3ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of IL20 transfected lysate using IL20 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with IL20 rabbit polyclonal antibody.)

product-image-AAA25428_IP4.jpg IP (Immunoprecipitation) (Immunoprecipitation of IL20 transfected lysate using IL20 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with IL20 rabbit polyclonal antibody.)

WB (Western Blot)

(Western Blot analysis of IL20 expression in transfected 293T cell line by IL20 monoclonal antibody Lane 1: IL20 transfected lysate (20.1kD). Lane 2: Non-transfected lysate.)

product-image-AAA25428_WB3.jpg WB (Western Blot) (Western Blot analysis of IL20 expression in transfected 293T cell line by IL20 monoclonal antibody Lane 1: IL20 transfected lysate (20.1kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(IL20 monoclonal antibody. Western Blot analysis of IL20 expression in A-431.)

product-image-AAA25428_WB2.jpg WB (Western Blot) (IL20 monoclonal antibody. Western Blot analysis of IL20 expression in A-431.)

WB (Western Blot)

(Western Blot detection against Immunogen (38.21kD).)

product-image-AAA25428_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (38.21kD).)
Related Product Information for anti-IL-20 antibody
The protein encoded by this gene is a cytokine structurally related to interleukin 10 (IL10). This cytokine has been shown to transduce its signal through signal transducer and activator of transcription 3 (STAT3) in keratinocytes. A specific receptor for this cytokine is found to be expressed in skin and upregulated dramatically in psoriatic skin, suggesting a role for this protein in epidermal function and psoriasis. [provided by RefSeq]
Product Categories/Family for anti-IL-20 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interleukin-20
NCBI Official Synonym Full Names
interleukin 20
NCBI Official Symbol
IL20
NCBI Official Synonym Symbols
IL-20; IL10D; ZCYTO10
NCBI Protein Information
interleukin-20
UniProt Protein Name
Interleukin-20
UniProt Gene Name
IL20
UniProt Synonym Gene Names
ZCYTO10; IL-20
UniProt Entry Name
IL20_HUMAN

Similar Products

Product Notes

The IL-20 il20 (Catalog #AAA25428) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Interleukin 20 (Interleukin-20, IL-20, IL20, Cytokine Zcyto10, IL10D, MGC96907, UNQ852/PRO1801, ZCYTO10) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Interleukin 20 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL-20 il20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Interleukin 20, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.