Mouse KLF10 Monoclonal Antibody | anti-KLF10 antibody

KLF10 (Kruppel-like Factor 10, EGRA, TIEG, TIEG1) (APC)

Cat. Num. AAA26132

• Gene Names: KLF10; EGRA; TIEG; TIEG1; EGR-alpha
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: KLF10, Antibody; KLF10 (Kruppel-like Factor 10, EGRA, TIEG, TIEG1) (APC); Kruppel-like Factor 10; EGRA; TIEG; TIEG1; anti-KLF10 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1H3
• Specificity: Recognizes KLF10.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 469

• Applicable Applications for anti-KLF10 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: KLF10 (AAH11538.1, 111aa-210aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVD
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(KLF10 monoclonal antibody (M15), clone 1H3. Western Blot analysis of KLF10 expression in PC-12.)

WB (Western Blot)

(KLF10 monoclonal antibody (M15), clone 1H3. Western Blot analysis of KLF10 expression in NIH/3T3.)

WB (Western Blot)

(KLF10 monoclonal antibody (M15), clone 1H3. Western Blot analysis of KLF10 expression in Jurkat.)

WB (Western Blot)

(KLF10 monoclonal antibody (M15), clone 1H3. Western Blot analysis of KLF10 expression in A-549.)

WB (Western Blot)

(KLF10 monoclonal antibody (M15), clone 1H3. Western Blot analysis of KLF10 expression in human colon.)

WB (Western Blot)

(KLF10 monoclonal antibody (M15), clone 1H3. Western Blot analysis of KLF10 expression in Y-79.)

Related Product Information for anti-KLF10 antibody

Mouse monoclonal antibody raised against a partial recombinant KLF10.

Product Categories/Family for anti-KLF10 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 15079389
• NCBI GeneID: 7071
• NCBI Official Full Name: Kruppel-like factor 10
• NCBI Official Synonym Full Names: Kruppel like factor 10
• NCBI Official Symbol: KLF10
• NCBI Official Synonym Symbols: EGRA; TIEG; TIEG1; EGR-alpha
• NCBI Protein Information: Krueppel-like factor 10