Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA26139_IF6.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to MAPK9 on HeLa cell. [antibody concentration 10 ug/ml])

Mouse MAPK9 Monoclonal Antibody | anti-MAPK9 antibody

MAPK9 (Mitogen-Activated Protein Kinase 9, JNK-55, JNK2, JNK2A, JNK2ALPHA, JNK2B, JNK2BETA, PRKM9, SAPK, p54a, p54aSAPK) (APC)

Gene Names
MAPK9; JNK2; SAPK; p54a; JNK2A; JNK2B; PRKM9; JNK-55; SAPK1a; JNK2BETA; p54aSAPK; JNK2ALPHA
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
MAPK9, Antibody; MAPK9 (Mitogen-Activated Protein Kinase 9, JNK-55, JNK2, JNK2A, JNK2ALPHA, JNK2B, JNK2BETA, PRKM9, SAPK, p54a, p54aSAPK) (APC); Mitogen-Activated Protein Kinase 9; JNK-55; JNK2; JNK2A; JNK2ALPHA; JNK2B; JNK2BETA; PRKM9; SAPK; p54a; p54aSAPK; anti-MAPK9 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D6
Specificity
Recognizes MAPK9.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
424
Applicable Applications for anti-MAPK9 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MAPK9 (AAH32539, 321aa-424aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEVMDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPLEGCR
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to MAPK9 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26139_IF6.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to MAPK9 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to MAPK9 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26139_IF5.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to MAPK9 on HeLa cell. [antibody concentration 10 ug/ml])

WB (Western Blot)

(MAPK9 monoclonal antibody (M05), clone 1D6. Western Blot analysis of MAPK9 expression in Raw 264.7.)

product-image-AAA26139_WB4.jpg WB (Western Blot) (MAPK9 monoclonal antibody (M05), clone 1D6. Western Blot analysis of MAPK9 expression in Raw 264.7.)

WB (Western Blot)

(MAPK9 monoclonal antibody (M05), clone 1D6. Western Blot analysis of MAPK9 expression in PC-12.)

product-image-AAA26139_WB3.jpg WB (Western Blot) (MAPK9 monoclonal antibody (M05), clone 1D6. Western Blot analysis of MAPK9 expression in PC-12.)

WB (Western Blot)

(MAPK9 monoclonal antibody (M05), clone 1D6. Western Blot analysis of MAPK9 expression in human liver.)

product-image-AAA26139_WB2.jpg WB (Western Blot) (MAPK9 monoclonal antibody (M05), clone 1D6. Western Blot analysis of MAPK9 expression in human liver.)

WB (Western Blot)

(MAPK9 monoclonal antibody (M05), clone 1D6. Western Blot analysis of MAPK9 expression in HepG2 (Cat # L019V1).)

product-image-AAA26139_WB.jpg WB (Western Blot) (MAPK9 monoclonal antibody (M05), clone 1D6. Western Blot analysis of MAPK9 expression in HepG2 (Cat # L019V1).)
Related Product Information for anti-MAPK9 antibody
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase targets specific transcription factors, and thus mediates immediate-early gene expression in response to various cell stimuli. It is most closely related to MAPK8, both of which are involved in UV radiation induced apoptosis, thought to be related to the cytochrome c-mediated cell death pathway. This gene and MAPK8 are also known as c-Jun N-terminal kinases. This kinase blocks the ubiquitination of tumor suppressor p53, and thus it increases the stability of p53 in nonstressed cells. Studies of this gene's mouse counterpart suggest a key role in T-cell differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]
Product Categories/Family for anti-MAPK9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Mitogen-activated protein kinase 9
NCBI Official Synonym Full Names
mitogen-activated protein kinase 9
NCBI Official Symbol
MAPK9
NCBI Official Synonym Symbols
JNK2; SAPK; p54a; JNK2A; JNK2B; PRKM9; JNK-55; SAPK1a; JNK2BETA; p54aSAPK; JNK2ALPHA
NCBI Protein Information
mitogen-activated protein kinase 9

Similar Products

Product Notes

The MAPK9 (Catalog #AAA26139) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MAPK9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAPK9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAPK9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.