Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA25451_APP6.jpg Application Data (Proximity Ligation Analysis of protein-protein interactions between TP53 and MDM2 HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-MDM2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Mouse anti-Human MDM2 Monoclonal Antibody | anti-MDM2 antibody

MDM2 (E3 Ubiquitin-protein Ligase Mdm2, Double Minute 2 Protein, Hdm2, Oncoprotein Mdm2, p53-binding Protein Mdm2) (HRP)

Gene Names
MDM2; HDMX; hdm2; ACTFS
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MDM2, Antibody; MDM2 (E3 Ubiquitin-protein Ligase Mdm2, Double Minute 2 Protein, Hdm2, Oncoprotein Mdm2, p53-binding Protein Mdm2) (HRP); anti-MDM2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A7
Specificity
Recognizes human MDM2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-MDM2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1.5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa101-200 from human MDM2 (NP_002383) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALC
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Proximity Ligation Analysis of protein-protein interactions between TP53 and MDM2 HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-MDM2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

product-image-AAA25451_APP6.jpg Application Data (Proximity Ligation Analysis of protein-protein interactions between TP53 and MDM2 HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-MDM2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

WB (Western Blot)

(Western blot analysis of MDM2 over-expressed 293 cell line, cotransfected with MDM2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MDM2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

product-image-AAA25451_WB5.jpg WB (Western Blot) (Western blot analysis of MDM2 over-expressed 293 cell line, cotransfected with MDM2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MDM2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged MDM2 is ~0.03ng/ml as a capture antibody.)

product-image-AAA25451_APP4.jpg Application Data (Detection limit for recombinant GST tagged MDM2 is ~0.03ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to MDM2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 1.5ug/ml])

product-image-AAA25451_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to MDM2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 1.5ug/ml])

WB (Western Blot)

(Western Blot analysis of MDM2 expression in transfected 293T cell line by MDM2 monoclonal antibody. Lane 1: MDM2 transfected lysate (55.2kD). Lane 2: Non-transfected lysate.)

product-image-AAA25451_WB2.jpg WB (Western Blot) (Western Blot analysis of MDM2 expression in transfected 293T cell line by MDM2 monoclonal antibody. Lane 1: MDM2 transfected lysate (55.2kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.74kD).)

product-image-AAA25451_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (36.74kD).)
Product Categories/Family for anti-MDM2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,133 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase Mdm2 isoform a
NCBI Official Synonym Full Names
MDM2 proto-oncogene, E3 ubiquitin protein ligase
NCBI Official Symbol
MDM2
NCBI Official Synonym Symbols
HDMX; hdm2; ACTFS
NCBI Protein Information
E3 ubiquitin-protein ligase Mdm2; MDM2 oncogene, E3 ubiquitin protein ligase; Mdm2, p53 E3 ubiquitin protein ligase homolog; Mdm2, transformed 3T3 cell double minute 2, p53 binding protein; double minute 2, human homolog of; p53-binding protein; oncoprote
UniProt Protein Name
Mdm2
UniProt Gene Name
mdm2
UniProt Entry Name
A7UKX7_HUMAN

Similar Products

Product Notes

The MDM2 mdm2 (Catalog #AAA25451) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MDM2 (E3 Ubiquitin-protein Ligase Mdm2, Double Minute 2 Protein, Hdm2, Oncoprotein Mdm2, p53-binding Protein Mdm2) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MDM2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1.5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MDM2 mdm2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MDM2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.