Mouse anti-Human MPG Monoclonal Antibody | anti-MPG antibody

MPG (DNA-3-methyladenine Glycosylase, 3-alkyladenine DNA Glycosylase, 3-methyladenine DNA Glycosidase, ADPG, N-methylpurine-DNA Glycosylase, AAG, ANPG, MID1) (Biotin)

Cat. Num. AAA24869

• Gene Names: MPG; AAG; MDG; ADPG; APNG; Mid1; anpg; PIG11; PIG16; CRA36.1
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MPG, Antibody; MPG (DNA-3-methyladenine Glycosylase, 3-alkyladenine DNA Glycosylase, 3-methyladenine DNA Glycosidase, ADPG, N-methylpurine-DNA Glycosylase, AAG, ANPG, MID1) (Biotin); anti-MPG antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1E10
• Specificity: Recognizes human MPG.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-MPG antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 40ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-90 from human MPG (AAH14991) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MPARSGAQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRERCLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPA
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged MPG is ~0.03ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to MPG on HeLa cell. [antibody concentration 40ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to MPG on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of MPG expression in transfected 293T cell line by MPG monoclonal antibody. Lane 1: MPG transfected lysate (32.2kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(MPG monoclonal antibody Western Blot analysis of MPG expression in Hela NE.)

WB (Western Blot)

(Western Blot detection against Immunogen (35.53kD).)

Product Categories/Family for anti-MPG antibody

Antibodies; Enzymes; Glycosidase

References

1. Chk2-dependent phosphorylation of XRCC1 in the DNA damage response promotes base excision repair. Chou WC, Wang HC, Wong FH, Ding SL, Wu PE, Shieh SY, Shen CY.EMBO J. 2008 Dec 3;27(23):3140-50. Epub 2008 Oct 30.

NCBI and Uniprot Product Information

• NCBI GI #: 15929072
• NCBI GeneID: 4350
• Molecular Weight: 30,824 Da
• NCBI Official Full Name: Homo sapiens N-methylpurine-DNA glycosylase, mRNA
• NCBI Official Synonym Full Names: N-methylpurine DNA glycosylase
• NCBI Official Symbol: MPG
• NCBI Official Synonym Symbols: AAG; MDG; ADPG; APNG; Mid1; anpg; PIG11; PIG16; CRA36.1
• NCBI Protein Information: DNA-3-methyladenine glycosylase