Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Mouse anti-Human NDUFS4 Monoclonal Antibody | anti-NDUFS4 antibody

NDUFS4 (NADH Dehydrogenase (Ubiquinone) Fe-S Protein 4, Mitochondrial, NADH-Ubiquinone Oxidoreductase 18kD Subunit, Complex I-18kD, CI-18kD, Complex I-AQDQ, CI-AQDQ) (HRP)

Gene Names
NDUFS4; AQDQ; CI-18; CI-AQDQ; CI-18 kDa
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NDUFS4, Antibody; NDUFS4 (NADH Dehydrogenase (Ubiquinone) Fe-S Protein 4, Mitochondrial, NADH-Ubiquinone Oxidoreductase 18kD Subunit, Complex I-18kD, CI-18kD, Complex I-AQDQ, CI-AQDQ) (HRP); anti-NDUFS4 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A1
Specificity
Recognizes human NDUFS4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-NDUFS4 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa66-175 from human NDUFS4 (NP_002486) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western blot analysis of NDUFS4 over-expressed 293 cell line, cotransfected with NDUFS4 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with NDUFS4 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged NDUFS4 is ~0.3ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to NDUFS4 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1ug/ml])

WB (Western Blot)

(Western Blot analysis of NDUFS4 expression in transfected 293T cell line by NDUFS4 monoclonal antibody. Lane 1: NDUFS4 transfected lysate (20.1kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(NDUFS4 monoclonal antibody Western Blot analysis of NDUFS4 expression in A-431.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.84kD).)

Product Categories/Family for anti-NDUFS4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15.5 kDa (134aa), confirmed by MALDI-TOF.
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH:ubiquinone oxidoreductase subunit S4
NCBI Official Symbol
NDUFS4
NCBI Official Synonym Symbols
AQDQ; CI-18; CI-AQDQ; CI-18 kDa
NCBI Protein Information
NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
UniProt Protein Name
NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
UniProt Gene Name
NDUFS4
UniProt Synonym Gene Names
CI-18 kDa; CI-AQDQ
UniProt Entry Name
NDUS4_HUMAN

Similar Products

Product Notes

The NDUFS4 ndufs4 (Catalog #AAA25467) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NDUFS4 (NADH Dehydrogenase (Ubiquinone) Fe-S Protein 4, Mitochondrial, NADH-Ubiquinone Oxidoreductase 18kD Subunit, Complex I-18kD, CI-18kD, Complex I-AQDQ, CI-AQDQ) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFS4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NDUFS4 ndufs4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NDUFS4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.