Rabbit anti-Human NeuN Monoclonal Antibody | anti-RBFOX3 antibody

NeuN Rabbit mAb

Cat. Num. AAA28482

• Reactivity: Human
• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, ELISA
• Purity: Affinity purification
• Synonyms: NeuN, Antibody; NeuN Rabbit mAb; FOX3; NEUN; FOX-3; HRNBP3; NeuN; anti-RBFOX3 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.09% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
• Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR

• Applicable Applications for anti-RBFOX3 antibody: Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), ELISA (EIA)
• Application Notes: WB: 1:1000-1:6000; IHC-P: 1:500-1:2000; IF/ICC: 1:200-1:800; ELISA: Recommended starting concentration is 1ug/mL.; Please optimize the concentration based on your specific assay requirements.
• Cross Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NeuN (A6NFN3).
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded rat brain tissue using NeuN Rabbit mAb (AAA28482, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded mouse brain tissue using NeuN Rabbit mAb (AAA28482, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded human brain tissue using NeuN Rabbit mAb (AAA28482, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using NeuN Rabbit mAb (AAA28482) at a dilution of 1?2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using NeuN Rabbit mAb (AAA28482) at a dilution of 1?2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human brain tissue using NeuN Rabbit mAb (AAA28482) at a dilution of 1?2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using NeuN Rabbit mAb (AAA28482) at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Related Product Information for anti-RBFOX3 antibody

This gene encodes a member of the RNA-binding FOX protein family which is involved in the regulation of alternative splicing of pre-mRNA. The protein has an N-terminal proline-rich region, an RNA recognition motif (RRM) domain, and a C-terminal alanine-rich region. This gene produces the neuronal nuclei (NeuN) antigen that has been widely used as a marker for post-mitotic neurons. This gene has its highest expression in the central nervous system and plays a prominent role in neural tissue development and regulation of adult brain function. Mutations in this gene have been associated with numerous neurological disorders. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.

Product Categories/Family for anti-RBFOX3 antibody

Epigenetics Nuclear Signaling; Transcription Factors; Neuroscience; Cell Type Marker; Neuron marker; Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 322510139
• NCBI GeneID: 146713
• UniProt Accession #: A6NFN3; B4DEG6; B4DF29
• Molecular Weight: Calculated MW: 34kDa; Observed MW: 46-55kDa
• UniProt Protein Name: RNA binding protein fox-1 homolog 3
• UniProt Gene Name: RBFOX3
• UniProt Entry Name: RFOX3_HUMAN