Mouse anti-Human PRPH Monoclonal Antibody | anti-PRPH antibody

PRPH (Peripherin, Neurofilament 4, NEF4, PRPH1) (Biotin)

Cat. Num. AAA24920

• Gene Names: PRPH; NEF4; PRPH1
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PRPH, Antibody; PRPH (Peripherin, Neurofilament 4, NEF4, PRPH1) (Biotin); anti-PRPH antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3B3
• Specificity: Recognizes human PRPH.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Concentration: 0.35mg/mL (varies by lot)
• Sequence: RHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY

• Applicable Applications for anti-PRPH antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Immunohistochemistry: Formalin fixed, paraffin embedded tissues.; Optimal dilutions to be determined by the researcher.
• Immunogen: Partial recombinant protein corresponding to aa374-470 of human PRPH with GST tag. MW of the GST tag alone is 26kD.
• Conjugate: Biotin
• Grade: Affinity purified
• Preparation and Storage: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

IF (Immunofluorescence)

(Immunofluorescence of on HeLa cell using AAA24920 (10ug/ml).)

IHC (Immunohistochemistry)

(Immunoperoxidase of formalin-fixed paraffin-embedded human placenta using AAA24920 (3ug/ml).)

WB (Western Blot)

(Western Blot analysis of PRPH expression in IMR-32 using AAA24920.)

Application Data

(Detection limit for recombinant GST tagged PRPH is 1ng/ml using AAA24920 as a capture antibody.)

Related Product Information for anti-PRPH antibody

Peripherin is a 57kD type III intermediate filament that is a specific marker for peripheral neurons, including enteric ganglion cells. Peripherin is expressed in the developing peripheral nervous system and is highly enriched in neuronal derivatives of the neural crest. Peripherin offers an advantage over other neural markers, such as S100 and NSE in that it does not stain chrmaffin cell types.

Product Categories/Family for anti-PRPH antibody

Antibodies; Peripherin

NCBI and Uniprot Product Information

• NCBI GI #: 21264345
• NCBI GeneID: 5630
• NCBI Accession #: NP_006253
• NCBI GenBank Nucleotide #: NM_006262
• UniProt Accession #: P41219; Q8N577
• NCBI Official Full Name: peripherin
• NCBI Official Synonym Full Names: peripherin
• NCBI Official Symbol: PRPH
• NCBI Official Synonym Symbols: NEF4; PRPH1
• NCBI Protein Information: peripherin; neurofilament 4 (57kD)
• UniProt Protein Name: Peripherin
• UniProt Gene Name: PRPH
• UniProt Synonym Gene Names: NEF4; PRPH1
• UniProt Entry Name: PERI_HUMAN