Mouse SIGLEC12 Monoclonal Antibody | anti-SIGLEC12 antibody
SIGLEC12 (Sialic Acid-binding Ig-like Lectin 12, Siglec-12, Siglec-XII, S2V, Sialic Acid-binding Ig-like Lectin-like 1, SIGLECL1, Siglec-L1, SLG, UNQ9215/PRO34042)
Gene Names
SIGLEC12; S2V; SLG; SIGLECL1; Siglec-XII
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
SIGLEC12, Antibody; SIGLEC12 (Sialic Acid-binding Ig-like Lectin 12, Siglec-12, Siglec-XII, S2V, Sialic Acid-binding Ig-like Lectin-like 1, SIGLECL1, Siglec-L1, SLG, UNQ9215/PRO34042); Anti -SIGLEC12 (Sialic Acid-binding Ig-like Lectin 12, Siglec-12, Siglec-XII, S2V, Sialic Acid-binding Ig-like Lectin-like 1, SIGLECL1, Siglec-L1, SLG, UNQ9215/PRO34042); anti-SIGLEC12 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D1
Specificity
Recognizes human SIGLEC12.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.4
Concentration
1mg/ml (varies by lot)
Sequence
RSCRKKSARPAVGVGDTGMEDANAVRGSASQGPLIESPADDSPPHHAPPALATPSPEEGEIQYASLSFHKARPQYPQEQEAIGYEYSEINIPK
Applicable Applications for anti-SIGLEC12 antibody
ELISA (EL/EIA), Western Blot (WB). Other applications not tested.
Application Notes
Optimal dilutions to be determined by the researcher.
Immunogen
Partial recombinant protein corresponding to aa503-595 fromhuman SIGLEC12 with GST tag. MW of the GST tag alone is 26kD
Preparation and Storage
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-SIGLEC12 antibody
Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging to the immunoglobulin superfamily. They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. This gene encodes a member of the SIGLEC3-like subfamily of SIGLECs. Members of this subfamily are characterized by an extracellular V-set immunoglobulin-like domain followed by two C2-set immunoglobulin-like domains, and the cytoplasmic tyrosine-based motifs ITIM and SLAM-like. The encoded protein, upon tyrosine phosphorylation, has been shown to recruit the Src homology 2 domain-containing
protein-tyrosine phosphatases SHP1 and SHP2. It has been suggested that the protein is involved in the negative regulation of macrophage signaling by functioning as an inhibitory receptor.
Product Categories/Family for anti-SIGLEC12 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
sialic acid-binding Ig-like lectin 12 isoform a
NCBI Official Synonym Full Names
sialic acid binding Ig-like lectin 12 (gene/pseudogene)
NCBI Official Symbol
SIGLEC12
NCBI Official Synonym Symbols
S2V; SLG; SIGLECL1; Siglec-XII
NCBI Protein Information
sialic acid-binding Ig-like lectin 12; SIGLEC-like 1; sialic acid-binding Ig-like lectin-like 1
UniProt Protein Name
Sialic acid-binding Ig-like lectin 12
UniProt Gene Name
SIGLEC12
UniProt Synonym Gene Names
SIGLECL1; SLG; Siglec-12; Siglec-L1
UniProt Entry Name
SIG12_HUMAN
Similar Products
Product Notes
The SIGLEC12 siglec12 (Catalog #AAA24042) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SIGLEC12 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Other applications not tested. Optimal dilutions to be determined by the researcher. Researchers should empirically determine the suitability of the SIGLEC12 siglec12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RSCRKKSARP AVGVGDTGME DANAVRGSAS QGPLIESPAD DSPPHHAPPA LATPSPEEGE IQYASLSFHK ARPQYPQEQE AIGYEYSEIN IPK. It is sometimes possible for the material contained within the vial of "SIGLEC12, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.