<
Mouse SMAD1 Monoclonal Antibody | anti-SMAD1 antibody
SMAD1 (SMAD Family Member 1, BSP1, JV4-1, JV41, MADH1, MADR1) (AP)
Gene Names
SMAD1; BSP1; JV41; BSP-1; JV4-1; MADH1; MADR1
Applications
Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
SMAD1, Antibody; SMAD1 (SMAD Family Member 1, BSP1, JV4-1, JV41, MADH1, MADR1) (AP); SMAD Family Member 1; BSP1; JV4-1; JV41; MADH1; MADR1; anti-SMAD1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2.0e+9
Specificity
Recognizes SMAD1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SMAD1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SMAD1 (AAH01878.1, 1aa-465aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
WB (Western Blot)
(SMAD1 monoclonal antibody (M03), clone 2E9. Western Blot analysis of SMAD1 expression in IMR-32.)
IF (Immunofluorescence)
(Immunofluorescence of monoclonal antibody to SMAD1 on HeLa cell. [antibody concentration 10 ug/ml])
IF (Immunofluorescence)
(Immunofluorescence of monoclonal antibody to SMAD1 on HeLa cell. [antibody concentration 10 ug/ml])
WB (Western Blot)
(SMAD1 monoclonal antibody (M03), clone 2E9 Western Blot analysis of SMAD1 expression in HeLa.)
IHC (Immunohistochemistry)
(Immunoperoxidase of monoclonal antibody to SMAD1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml])
Application Data
(Immunoperoxidase of monoclonal antibody to SMAD1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml])
Related Product Information for anti-SMAD1 antibody
The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signals of the bone morphogenetic proteins (BMPs), which are involved in a range of biological activities including cell growth, apoptosis, morphogenesis, development and immune responses. In response to BMP ligands, this protein can be phosphorylated and activated by the BMP receptor kinase. The phosphorylated form of this protein forms a complex with SMAD4, which is important for its function in the transcription regulation. This protein is a target for SMAD-specific E3 ubiquitin ligases, such as SMURF1 and SMURF2, and undergoes ubiquitination and proteasome-mediated degradation. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq]
Product Categories/Family for anti-SMAD1 antibody
References
1. Temporal and regional patterns of Smad activation in the rat hippocampus following global ischemia. Nakajima T, Yanagihara M, Nishii HJ Neurol Sci. 2013 Nov 19. pii: S0022-510X(13)03041-4. doi: 10.1016/j.jns.2013.11. 012.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
52,260 Da
NCBI Official Full Name
SMAD family member 1
NCBI Official Synonym Full Names
SMAD family member 1
NCBI Official Symbol
SMAD1
NCBI Official Synonym Symbols
BSP1; JV41; BSP-1; JV4-1; MADH1; MADR1
NCBI Protein Information
mothers against decapentaplegic homolog 1; MAD homolog 1; Mad-related protein 1; TGF-beta signaling protein 1; mothers against DPP homolog 1; SMAD, mothers against DPP homolog 1; MAD, mothers against decapentaplegic homolog 1; transforming growth factor-b
