Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA24660_WB6.jpg WB (Western Blot) (Western Blot detection against Immunogen (34.21kD).)

Mouse anti-Human SMAD5 Monoclonal Antibody | anti-SMAD5 antibody

SMAD5 (Mothers Against Decapentaplegic Homolog 5, Mothers Against DPP Homolog 5, MAD Homolog 5, Mad5, SMAD Family Member 5, SMAD 5, Smad5, JV5-1, MADH5, DKFZp781C1895, DKFZp781O1323) APC

Gene Names
SMAD5; DWFC; JV5-1; MADH5
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SMAD5, Antibody; SMAD5 (Mothers Against Decapentaplegic Homolog 5, Mothers Against DPP Homolog 5, MAD Homolog 5, Mad5, SMAD Family Member 5, SMAD 5, Smad5, JV5-1, MADH5, DKFZp781C1895, DKFZp781O1323) APC; anti-SMAD5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D7
Specificity
Recognizes human SMAD5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-SMAD5 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa105-182 from human SMAD5 (AAH09682) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNN
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western Blot detection against Immunogen (34.21kD).)

product-image-AAA24660_WB6.jpg WB (Western Blot) (Western Blot detection against Immunogen (34.21kD).)

Application Data

(Detection limit for recombinant GST tagged SMAD5 is ~0.1ng/ml as a capture antibody.)

product-image-AAA24660_APP5.jpg Application Data (Detection limit for recombinant GST tagged SMAD5 is ~0.1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to SMAD5 on HeLa cell. [antibody concentration 10ug/ml])

product-image-AAA24660_IF4.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to SMAD5 on HeLa cell. [antibody concentration 10ug/ml])

WB (Western Blot)

(SMAD5 monoclonal antibody. Western Blot analysis of SMAD5 expression in K-562.)

product-image-AAA24660_WB3.jpg WB (Western Blot) (SMAD5 monoclonal antibody. Western Blot analysis of SMAD5 expression in K-562.)

WB (Western Blot)

(SMAD5 monoclonal antibody Western Blot analysis of SMAD5 expression in Jurkat.)

product-image-AAA24660_WB2.jpg WB (Western Blot) (SMAD5 monoclonal antibody Western Blot analysis of SMAD5 expression in Jurkat.)

WB (Western Blot)

(SMAD5 monoclonal antibody Western Blot analysis of SMAD5 expression in Hela NE.)

product-image-AAA24660_WB.jpg WB (Western Blot) (SMAD5 monoclonal antibody Western Blot analysis of SMAD5 expression in Hela NE.)
Product Categories/Family for anti-SMAD5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
52,258 Da
NCBI Official Full Name
Homo sapiens SMAD family member 5, mRNA
NCBI Official Synonym Full Names
SMAD family member 5
NCBI Official Symbol
SMAD5
NCBI Official Synonym Symbols
DWFC; JV5-1; MADH5
NCBI Protein Information
mothers against decapentaplegic homolog 5

Similar Products

Product Notes

The SMAD5 (Catalog #AAA24660) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SMAD5 (Mothers Against Decapentaplegic Homolog 5, Mothers Against DPP Homolog 5, MAD Homolog 5, Mad5, SMAD Family Member 5, SMAD 5, Smad5, JV5-1, MADH5, DKFZp781C1895, DKFZp781O1323) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SMAD5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMAD5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMAD5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.