Loading...

Skip to main content
Application Data (Detection limit for recombinant GST tagged SP1 is ~0.1ng/ml as a capture antibody.)

Mouse anti-Human, Mouse SP1 Monoclonal Antibody | anti-SP1 antibody

SP1 (Transcription Factor Sp1, TSFP1) (PE)

Reactivity
Human, Mouse
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SP1, Antibody; SP1 (Transcription Factor Sp1, TSFP1) (PE); anti-SP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG1
Clone Number
1A5
Specificity
Recognizes human SP1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SP1 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa89-199 from human SP1 (NP_612482) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQ*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged SP1 is ~0.1ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged SP1 is ~0.1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to SP1 on HeLa cell. [antibody concentration 10ug/ml].)

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to SP1 on HeLa cell. [antibody concentration 10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to SP1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1ug/ml].)

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to SP1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to SP1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1ug/ml].)

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to SP1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1ug/ml].)

WB (Western Blot)

(SP1 monoclonal antibody. Western Blot analysis of SP1 expression in NIH/3T3.)

WB (Western Blot) (SP1 monoclonal antibody. Western Blot analysis of SP1 expression in NIH/3T3.)

WB (Western Blot)

(SP1 monoclonal antibody, Western Blot analysis of SP1 expression in Hela NE.)

WB (Western Blot) (SP1 monoclonal antibody, Western Blot analysis of SP1 expression in Hela NE.)

WB (Western Blot)

(Western Blot detection against Immunogen (38.21kD).)

WB (Western Blot) (Western Blot detection against Immunogen (38.21kD).)
Product Categories/Family for anti-SP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75,824 Da
NCBI Official Full Name
transcription factor Sp1 isoform a
NCBI Official Synonym Full Names
Sp1 transcription factor
NCBI Official Symbol
SP1
NCBI Protein Information
transcription factor Sp1
UniProt Protein Name
Transcription factor Sp1
UniProt Gene Name
SP1
UniProt Synonym Gene Names
TSFP1
UniProt Entry Name
SP1_HUMAN

Similar Products

Product Notes

The SP1 sp1 (Catalog #AAA25851) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SP1 (Transcription Factor Sp1, TSFP1) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SP1 sp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.