Loading...

Skip to main content
Application Data (Detection limit for recombinant GST tagged STAT5B is approximately 0.3ng/ml as a capture antibody.)

Mouse STAT5B Monoclonal Antibody | anti-STAT5B antibody

STAT5B (Signal Transducer and Activator of Transcription 5B, STAT5) (Biotin)

Gene Names
STAT5B; STAT5
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
STAT5B, Antibody; STAT5B (Signal Transducer and Activator of Transcription 5B, STAT5) (Biotin); Signal Transducer and Activator of Transcription 5B; STAT5; anti-STAT5B antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D1
Specificity
Recognizes STAT5B.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-STAT5B antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
STAT5B (NP_036580, 678aa-787aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQWIPHAQS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged STAT5B is approximately 0.3ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged STAT5B is approximately 0.3ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to STAT5B on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 1.5 ug/ml])

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to STAT5B on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 1.5 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to STAT5B on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 1.5 ug/ml])

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to STAT5B on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 1.5 ug/ml])

WB (Western Blot)

(STAT5B monoclonal antibody (M03), clone 2D1 Western Blot analysis of STAT5B expression in HeLa.)

WB (Western Blot) (STAT5B monoclonal antibody (M03), clone 2D1 Western Blot analysis of STAT5B expression in HeLa.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to STAT5B on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to STAT5B on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to STAT5B on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to STAT5B on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-STAT5B antibody
The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. This gene was found to fuse to retinoic acid receptor-alpha (RARA) gene in a small subset of acute promyelocytic leukemias (APLL). The dysregulation of the signaling pathways mediated by this protein may be the cause of the APLL. [provided by RefSeq]
Product Categories/Family for anti-STAT5B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90kDa
NCBI Official Full Name
signal transducer and activator of transcription 5B
NCBI Official Synonym Full Names
signal transducer and activator of transcription 5B
NCBI Official Symbol
STAT5B
NCBI Official Synonym Symbols
STAT5
NCBI Protein Information
signal transducer and activator of transcription 5B
UniProt Protein Name
Signal transducer and activator of transcription 5B
UniProt Gene Name
STAT5B
UniProt Entry Name
STA5B_HUMAN

Similar Products

Product Notes

The STAT5B stat5b (Catalog #AAA26204) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's STAT5B can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STAT5B stat5b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STAT5B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.