Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26015_APP6.jpg Application Data (Detection limit for recombinant GST tagged STIP1 is 0.03 ng/ml as a capture antibody.)

Mouse STIP1 Monoclonal Antibody | anti-STIP1 antibody

STIP1 (Stress-Induced-Phosphoprotein 1, HOP, IEF-SSP-3521, P60, STI1, STI1L) (AP)

Average rating 0.0
No ratings yet
Gene Names
STIP1; HOP; P60; STI1; STI1L; HEL-S-94n; IEF-SSP-3521
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
STIP1, Antibody; STIP1 (Stress-Induced-Phosphoprotein 1, HOP, IEF-SSP-3521, P60, STI1, STI1L) (AP); Stress-Induced-Phosphoprotein 1; HOP; IEF-SSP-3521; P60; STI1; STI1L; anti-STIP1 antibody
Ordering
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C6
Specificity
Recognizes STIP1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-STIP1 antibody
ELISA, WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
STIP1 (NP_006810.1, 445aa-543aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged STIP1 is 0.03 ng/ml as a capture antibody.)

product-image-AAA26015_APP6.jpg Application Data (Detection limit for recombinant GST tagged STIP1 is 0.03 ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26015_IF5.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26015_IF4.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml])

WB (Western Blot)

(STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in NIH/3T3.)

product-image-AAA26015_WB3.jpg WB (Western Blot) (STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in NIH/3T3.)

WB (Western Blot)

(STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in PC-12.)

product-image-AAA26015_WB2.jpg WB (Western Blot) (STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in PC-12.)

WB (Western Blot)

(STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in Raw 264.7.)

product-image-AAA26015_WB.jpg WB (Western Blot) (STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in Raw 264.7.)
Related Product Information for anti-STIP1 antibody
Mouse monoclonal antibody raised against a partial recombinant STIP1.
Product Categories/Family for anti-STIP1 antibody
References
1. Secreted Stress-Induced Phosphoprotein 1 Activates the ALK2-SMAD Signaling Pathways and Promotes Cell Proliferation of Ovarian Cancer Cells. Tsai CL, Tsai CN, Lin CY, Chen HW, Lee YS, Chao A, Wang TH, Wang HS, Lai CH.Cell Rep. 2012 Aug 30;2(2):283-93. Epub 2012 Aug 9.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62,639 Da
NCBI Official Full Name
stress-induced-phosphoprotein 1 isoform b
NCBI Official Synonym Full Names
stress-induced phosphoprotein 1
NCBI Official Symbol
STIP1
NCBI Official Synonym Symbols
HOP; P60; STI1; STI1L; HEL-S-94n; IEF-SSP-3521
NCBI Protein Information
stress-induced-phosphoprotein 1; NY-REN-11 antigen; Hsp70/Hsp90-organizing protein; hsc70/Hsp90-organizing protein; renal carcinoma antigen NY-REN-11; transformation-sensitive protein IEF SSP 3521; epididymis secretory sperm binding protein Li 94n
UniProt Protein Name
Stress-induced-phosphoprotein 1
UniProt Gene Name
STIP1
UniProt Synonym Gene Names
STI1; Hop
UniProt Entry Name
STIP1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The STIP1 stip1 (Catalog #AAA26015) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's STIP1 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STIP1 stip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STIP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.